PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 100734 | ||||||||
Common Name | SELMODRAFT_100734 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 147aa MW: 16859.2 Da PI: 10.9231 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.2 | 7.9e-18 | 9 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+ Ed+ lv++vkq+G+++W++I+ m +R++kqc++rw ++l 100734 9 KGQWSLAEDKSLVKLVKQYGTRRWSLISTFMA-NRSGKQCRERWVNHL 55 799*****************************.************996 PP | |||||||
2 | Myb_DNA-binding | 60.5 | 3.7e-19 | 63 | 103 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 WT+eE+ellv+a+ +G++ W++Ia++++ gRt++++k++w+ 100734 63 GWTKEEEELLVQAHSYFGNK-WSAIAKMLP-GRTDNSIKNHWH 103 6*******************.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.184 | 4 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.23E-32 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.2E-15 | 8 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-25 | 10 | 62 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 2.8E-19 | 12 | 72 | No hit | No description |
CDD | cd00167 | 2.79E-13 | 12 | 55 | No hit | No description |
PROSITE profile | PS51294 | 26.048 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 9.8E-16 | 60 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-24 | 63 | 111 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.96E-12 | 64 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MGGQRNRVKG QWSLAEDKSL VKLVKQYGTR RWSLISTFMA NRSGKQCRER WVNHLQPDIR 60 KEGWTKEEEE LLVQAHSYFG NKWSAIAKML PGRTDNSIKN HWHAALRKKV IHLKLQSATT 120 FRMAGSAWQT EVQSFEGIHP AKDGQS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-41 | 8 | 110 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-41 | 8 | 110 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-41 | 8 | 110 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269|PubMed:24068955}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024395976.1 | 7e-58 | uncharacterized protein LOC112292072 | ||||
Swissprot | Q9FIM4 | 5e-42 | MY119_ARATH; Transcription factor MYB119 | ||||
TrEMBL | D8RS06 | 1e-104 | D8RS06_SELML; Uncharacterized protein | ||||
STRING | EFJ24785 | 1e-105 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58850.1 | 2e-44 | myb domain protein 119 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 100734 |
Entrez Gene | 9656393 |
Publications ? help Back to Top | |||
---|---|---|---|
|