PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 100288 | ||||||||
Common Name | SELMODRAFT_450037, SELMODRAFT_450048, SmHAP3D-1.2, SmHAP3D-2.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 126aa MW: 14077.8 Da PI: 5.0119 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.9 | 5.3e-57 | 30 | 123 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+y+eplk+yl+kyre+ 100288 30 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEEYLEPLKIYLQKYREVT 123 69******************************************************************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.8E-55 | 26 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.5E-40 | 33 | 122 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.4E-23 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.4E-23 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 4.4E-23 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MADVGSPRSQ DSPHSDDAGG HGGERDNSNV REQDRFLPIA NISRIMKKAL PANAKIAKDA 60 KETVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM STLGFEEYLE PLKIYLQKYR 120 EVTEL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-48 | 29 | 121 | 1 | 93 | NF-YB |
4awl_B | 1e-48 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-48 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019905 | 0.0 | Selaginella moellendorffii CCAAT-box binding factor HAP3-like protein (HAP3D2) mRNA, HAP3D2-8 allele, partial cds |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002974019.1 | 3e-87 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_002974020.1 | 4e-87 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_002983471.1 | 3e-87 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_024534627.1 | 4e-87 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_024534628.1 | 3e-87 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
Refseq | XP_024544405.1 | 3e-87 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O23310 | 7e-64 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | D8RRZ6 | 1e-88 | D8RRZ6_SELML; CCAAT-box binding factor HAP3 | ||||
STRING | EFJ15373 | 2e-86 | (Selaginella moellendorffii) | ||||
STRING | EFJ24975 | 2e-86 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-66 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 100288 |
Entrez Gene | 9654958 | 9656385 |
Publications ? help Back to Top | |||
---|---|---|---|
|