PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00029915-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 157aa MW: 17551.5 Da PI: 4.8782 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 163.1 | 4e-51 | 35 | 129 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 eq+r++Pianv+rimk++lP nak+sk+aket+qecvsefi+fvt+eas+kc++e+rkt+ngdd++wa+atlGf+dy+ pl+ yl++y SMil_00029915-RA_Salv 35 EQERLVPIANVGRIMKQILPPNAKVSKEAKETMQECVSEFIGFVTGEASEKCRKERRKTVNGDDVCWAMATLGFDDYAPPLRRYLERY 122 89************************************************************************************** PP NF-YB 91 relegek 97 rele ++ SMil_00029915-RA_Salv 123 RELEVDR 129 ****986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.7E-49 | 31 | 151 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.45E-37 | 36 | 149 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.0E-26 | 40 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-16 | 67 | 85 | No hit | No description |
PRINTS | PR00615 | 1.2E-16 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 1.2E-16 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MSTSNNNNDN NNSFDSSKAV FSISMAESGS SLAGEQERLV PIANVGRIMK QILPPNAKVS 60 KEAKETMQEC VSEFIGFVTG EASEKCRKER RKTVNGDDVC WAMATLGFDD YAPPLRRYLE 120 RYRELEVDRV NQNKAGNSGE MDDNLLYTQN KPQRDSG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-41 | 35 | 124 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-41 | 35 | 124 | 3 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 3e-41 | 35 | 124 | 8 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011091059.2 | 6e-70 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 2e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A4D9BL24 | 2e-71 | A0A4D9BL24_SALSN; Uncharacterized protein | ||||
STRING | cassava4.1_018746m | 6e-63 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-49 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|