PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00029595-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13878 Da PI: 8.4811 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 136.4 | 8.1e-43 | 2 | 94 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 r+ ++++Pian++rim+++lP++ak+++daket+qecv+ef+s++tsea+ +c+ e rkti+++d++ a++ lGf+dyv pl+++l++yr SMil_00029595-RA_Salv 2 RKAEEYMPIANIMRIMRRILPSQAKVADDAKETIQECVTEFMSYITSEANARCHSECRKTITAEDVVGAMGALGFHDYVYPLTLFLHNYR 91 67899************************************************************************************* PP NF-YB 92 ele 94 + SMil_00029595-RA_Salv 92 AQD 94 865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.0E-40 | 2 | 98 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.45E-33 | 6 | 107 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-21 | 8 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.5E-9 | 35 | 53 | No hit | No description |
PRINTS | PR00615 | 2.5E-9 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 2.5E-9 | 73 | 91 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MRKAEEYMPI ANIMRIMRRI LPSQAKVADD AKETIQECVT EFMSYITSEA NARCHSECRK 60 TITAEDVVGA MGALGFHDYV YPLTLFLHNY RAQDPHRRPM MPPPPRRTQT ASSPLDFGLF 120 K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-42 | 1 | 91 | 6 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095575.1 | 1e-43 | nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 3e-40 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A2G9GM53 | 2e-42 | A0A2G9GM53_9LAMI; Uncharacterized protein | ||||
TrEMBL | A0A438K087 | 7e-43 | A0A438K087_VITVI; Nuclear transcription factor Y subunit B-6 | ||||
STRING | AES60017 | 3e-42 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6044 | 4 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 5e-43 | nuclear factor Y, subunit B6 |