PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029184-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family MYB
Protein Properties Length: 374aa    MW: 42034.1 Da    PI: 5.9128
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029184-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-18203249148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g WT+eEd ll+++v+++G + W++Ia+ +  gR +kqc++rw+++l
  SMil_00029184-RA_Salv 203 KGQWTPEEDRLLIHLVEKYGEKKWSRIAQVVK-GRIGKQCRERWHNHL 249
                            799****************************9.*************97 PP

2Myb_DNA-binding50.74.2e-16255297145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++ WT+eEd +l++a+++ G++ W+  a+++  gRt++++k++w+
  SMil_00029184-RA_Salv 255 KDVWTEEEDRILIEAHAEIGNK-WAEMAKRLA-GRTENSIKNHWN 297
                            578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
PROSITE profilePS5129429.903198253IPR017930Myb domain
SMARTSM007173.5E-18202251IPR001005SANT/Myb domain
PfamPF002495.3E-18203249IPR001005SANT/Myb domain
SuperFamilySSF466896.47E-31203296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27204255IPR009057Homeodomain-like
CDDcd001672.91E-17206249No hitNo description
PROSITE profilePS5129420.632254304IPR017930Myb domain
SMARTSM007175.5E-16254302IPR001005SANT/Myb domain
PfamPF002491.2E-14255297IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-22256304IPR009057Homeodomain-like
CDDcd001671.06E-12258300No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MPKTHYTSLS FGCTSTLLGC AGRHLGCTAA QTSFLTAQEG ILAAHASSVY LKFEVIDDEF  60
SIDNFPSSLQ LQDFHQLDQL PLIKASSFNT VIDTDPFFHG FDFYEVDGKP YDDDDRNGMG  120
CAAMQGFHGG GFLNFDDSGK DLLMELDAAS INEDPKPLSI VFADESSCVT ADFHKENGVK  180
RDKYGANDTA SASAKTPKAK SGKGQWTPEE DRLLIHLVEK YGEKKWSRIA QVVKGRIGKQ  240
CRERWHNHLR PDIKKDVWTE EEDRILIEAH AEIGNKWAEM AKRLAGRTEN SIKNHWNATK  300
RRQLSRRKCR PTSLLQNYIK SLSLEKGSRS LRNTTAPDIE MDDFSFMDDF GSAPPPCFEM  360
DLHGLKEDFD FAMG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-482033044105C-Myb DNA-Binding Domain
1msf_C6e-482033044105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594190.0KF059419.1 Salvia miltiorrhiza MYB-related transcription factor (MYB65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101317.11e-106transcription factor MYB98-like
SwissprotQ9S7L22e-70MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A059PRU10.0A0A059PRU1_SALMI; MYB-related transcription factor
STRINGMigut.D01939.1.p8e-95(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-68myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]