PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00028851-RA_Salv
Common NameMYB9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family MYB
Protein Properties Length: 261aa    MW: 29835 Da    PI: 6.3974
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00028851-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-172370148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT +Ed  l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  SMil_00028851-RA_Salv 23 RGPWTVDEDFTLINYIAHHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 70
                           89********************************************97 PP

2Myb_DNA-binding51.72e-1676119146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  SMil_00028851-RA_Salv  76 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                            7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0691870IPR017930Myb domain
SuperFamilySSF466892.16E-3021117IPR009057Homeodomain-like
SMARTSM007173.5E-142272IPR001005SANT/Myb domain
PfamPF002495.0E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-212477IPR009057Homeodomain-like
CDDcd001671.02E-102570No hitNo description
PROSITE profilePS5129423.24671125IPR017930Myb domain
SMARTSM007171.3E-1475123IPR001005SANT/Myb domain
PfamPF002494.0E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2378124IPR009057Homeodomain-like
CDDcd001673.48E-796119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MDHHQDDTKS YSQSEEDLLE LRRGPWTVDE DFTLINYIAH HGEGRWNSLA RSAGLKRTGK  60
SCRLRWLNYL RPDVRRGNIT LEEQLLILEL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKHAKQLKC DVNSKQFKDT MRYLWMPRLV ERIQAAAAAA PNLDVAVALP RPENSSAAAS  180
SESFGTPASD LTDCYNNQDC YAANNNQFSY GDQLSLSSPS GYFNQGLDFG GQWAMDGGDA  240
SDSLWSVDDV WFLQQQFNTN A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252012324126MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0593630.0KF059363.1 Salvia miltiorrhiza MYB-related transcription factor (MYB9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028115735.11e-123transcription factor MYB108-like
SwissprotQ10MB43e-90MYB2_ORYSJ; Transcription factor MYB2
TrEMBLA0A059PRD90.0A0A059PRD9_SALMI; MYB-related transcription factor
STRINGXP_009612140.11e-118(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-82myb domain protein 78
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  3. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  4. Li C,Lu S
    Genome-wide characterization and comparative analysis of R2R3-MYB transcription factors shows the complexity of MYB-associated regulatory networks in Salvia miltiorrhiza.
    BMC Genomics, 2014. 15: p. 277
    [PMID:24725266]
  5. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  6. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]