PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00028032-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 142aa MW: 15569.8 Da PI: 8.3697 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 111 | 8.4e-35 | 15 | 91 | 1 | 77 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGav 77 +Ca+Ck+lr +C ++C++a yfpae+p kf nvhk+FGasnv+kll+++p+++red+++sl+yeAear++dPvyG+v SMil_00028032-RA_Salv 15 PCASCKFLRLRCLSGCIFAAYFPAEEPTKFVNVHKIFGASNVSKLLNEIPPHQREDTVKSLAYEAEARLKDPVYGCV 91 7***************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 20.94 | 14 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.2E-34 | 15 | 91 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MASSSSSSSS YSSPPCASCK FLRLRCLSGC IFAAYFPAEE PTKFVNVHKI FGASNVSKLL 60 NEIPPHQRED TVKSLAYEAE ARLKDPVYGC VWGPSPFFSA RSSPFSRSLT PPMLTSCALQ 120 PETELRLMEL QTSKKPNNPS VD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-43 | 12 | 95 | 8 | 91 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-43 | 12 | 95 | 8 | 91 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011097516.1 | 3e-48 | LOB domain-containing protein 25-like | ||||
Swissprot | Q9FML4 | 2e-43 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A1S4CXF4 | 1e-46 | A0A1S4CXF4_TOBAC; LOB domain-containing protein 25-like | ||||
STRING | XP_009597524.1 | 2e-47 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 3e-43 | LOB domain-containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|