PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025750-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRAS
Protein Properties Length: 545aa    MW: 59448.9 Da    PI: 4.6824
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025750-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS450.41.2e-1371755391374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            lv++L++cAeav++++++la+al++++  la ++  +m+++a+yf+eALa+r+++        + p e+ +++ s+ l++   f+e+ 
  SMil_00025750-RA_Salv 175 LVHTLMACAEAVQQENMKLADALVKHVGLLAVSQVGAMRKVATYFAEALARRIYK--------IYPHEALDSSLSDILQM--HFYETG 252
                            689***************************************************9........44555554556666555..5***** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P+lkf+h+taNqaIlea++g++rvH+iDf++ qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+f
  SMil_00025750-RA_Salv 253 PYLKFAHFTANQAILEAFAGANRVHVIDFSLRQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNSDALQQVGWKLAQLAETIGVEF 340
                            **************************************************************************************** PP

                   GRAS 177 efnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                            ef+ +v+++l+dl+ ++L+++   +E++aVn+v++lh+ll++++++e+    vL+ vk ++Pk+v+vveqea+hn++ Fl+rf eal+
  SMil_00025750-RA_Salv 341 EFRGFVTNSLADLDADMLEIRGgdEETVAVNSVFELHQLLARPGAIEK----VLDSVKAMRPKIVTVVEQEANHNGSAFLDRFNEALH 424
                            *********************9989***********************....************************************ PP

                   GRAS 263 yysalfdsleak..lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sd 347
                            yys++fdsle +    ++  ++ ++ +++lgr+i+nvvac gaer+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +d
  SMil_00025750-RA_Salv 425 YYSTMFDSLECSesTQPDGTQDLMMTEVYLGRQICNVVACDGAERVERHETLAQWRGRMNSAGFDPVHLGSNAFKQASMLLALFSsGD 512
                            *********6551144455999****************************************************************** PP

                   GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                            gyrvee++gsl+lgW++rpL+++SaWr
  SMil_00025750-RA_Salv 513 GYRVEESDGSLMLGWHTRPLIATSAWR 539
                            **************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120412.7E-332994IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.3E-3229102No hitNo description
PROSITE profilePS5098568.059149518IPR005202Transcription factor GRAS
PfamPF035144.1E-135175539IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MKRDRDRGKA AAAGKPKMWT EPQADAGMDD LFAVLGYKVK SSDMADVAEK LEQLEMAMGT  60
TADDGVSVLA NDSVHYNPSD LSGWVESMLS ELSSSCGFDN DMGISGESSS SKFINFSGDD  120
DLRAIPGGAV FGNKQKEESE NGSKRMKGSE FAENCSPASA TRSVVVDSQE TGVRLVHTLM  180
ACAEAVQQEN MKLADALVKH VGLLAVSQVG AMRKVATYFA EALARRIYKI YPHEALDSSL  240
SDILQMHFYE TGPYLKFAHF TANQAILEAF AGANRVHVID FSLRQGMQWP ALMQALALRP  300
GGPPAFRLTG IGPPQPDNSD ALQQVGWKLA QLAETIGVEF EFRGFVTNSL ADLDADMLEI  360
RGGDEETVAV NSVFELHQLL ARPGAIEKVL DSVKAMRPKI VTVVEQEANH NGSAFLDRFN  420
EALHYYSTMF DSLECSESTQ PDGTQDLMMT EVYLGRQICN VVACDGAERV ERHETLAQWR  480
GRMNSAGFDP VHLGSNAFKQ ASMLLALFSS GDGYRVEESD GSLMLGWHTR PLIATSAWRI  540
TAPDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-6718253825377Protein SCARECROW
5b3h_D6e-6718253825377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097451.10.0DELLA protein GAI
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A4D8YZF20.0A0A4D8YZF2_SALSN; DELLA protein
STRINGMigut.K00894.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]