PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00019218-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 161aa MW: 18140.4 Da PI: 7.7149 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 156 | 6.2e-49 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 e+dr+lPi+nv+rimkk+lP+ akisk+aket+qecvsefi+fvtseas++c++e+rkt+ngdd++wal++lGf++y +++ yl++ r SMil_00019218-RA_Salv 3 DENDRLLPISNVGRIMKKILPTSAKISKEAKETMQECVSEFIGFVTSEASERCHKENRKTVNGDDICWALSSLGFDNYSDTMPRYLQRLR 92 589*************************************************************************************** PP NF-YB 92 elegek 97 e+e+++ SMil_00019218-RA_Salv 93 EIESQR 98 **9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.8E-48 | 2 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-36 | 5 | 105 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.1E-26 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-16 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 1.8E-16 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 1.8E-16 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MTDENDRLLP ISNVGRIMKK ILPTSAKISK EAKETMQECV SEFIGFVTSE ASERCHKENR 60 KTVNGDDICW ALSSLGFDNY SDTMPRYLQR LREIESQRAK QQGERKMKEG CCQCTPSSPP 120 SLHFVAILER DGGGERERES SSSSSAKTSQ LDNNTCILRK N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011092666.1 | 1e-56 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O82248 | 1e-49 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A4D9ATQ4 | 6e-54 | A0A4D9ATQ4_SALSN; Uncharacterized protein | ||||
STRING | XP_009760265.1 | 2e-52 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-51 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|