PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00018253-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 159aa MW: 16820.3 Da PI: 10.4296 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 127.5 | 4e-40 | 52 | 110 | 3 | 61 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++ SMil_00018253-RA_Salv 52 PENLRCPRCDSANTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKAT 110 57899***************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 2.2E-33 | 54 | 109 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.413 | 55 | 109 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 5.0E-24 | 55 | 105 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 57 | 93 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MIQELLGGSS VTIIGGDRSK LSTTTPCGGG GGGILDHASP SPSPPPSSAA APENLRCPRC 60 DSANTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI GGGCRKNKAT AIAAKSAAKL 120 RTPPPPQQQS EMALSPNSKP HDLGLPSKLP FPLPNPRKP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM084363 | 3e-57 | AM084363.1 Hordeum vulgare subsp. vulgare partial dof15 gene for dof zinc finger protein 15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020554970.1 | 3e-48 | dof zinc finger protein DOF1.1-like | ||||
Swissprot | Q84TE9 | 4e-37 | DOF53_ARATH; Dof zinc finger protein DOF5.3 | ||||
TrEMBL | A0A4D9BVI9 | 5e-46 | A0A4D9BVI9_SALSN; Uncharacterized protein | ||||
STRING | Solyc02g090310.1.1 | 1e-43 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400025984 | 2e-43 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA88 | 24 | 419 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60200.1 | 3e-33 | TARGET OF MONOPTEROS 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|