PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00018221-RA_Salv | ||||||||
Common Name | MYB20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 21353 Da PI: 8.4685 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.2 | 6e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEd +l+ av+ lG ++W++ a+ g++R++k+c++rw +yl SMil_00018221-RA_Salv 8 KGPWLEEEDNQLAAAVAVLGDKRWDALAKASGLRRSGKSCRLRWMNYL 55 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.7 | 4.8e-17 | 62 | 105 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g+ + eE+ +++d+++++G++ W++Iar+++ gRt++++k++w+++ SMil_00018221-RA_Salv 62 GNISVEEERIIIDLHQKWGNR-WSKIARRLP-GRTDNEIKNYWRSH 105 56789****************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.716 | 1 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.86E-28 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-13 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-20 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.38E-9 | 10 | 55 | No hit | No description |
PROSITE profile | PS51294 | 25.065 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 8.3E-16 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-15 | 62 | 105 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-24 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.28E-11 | 65 | 105 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MQEAEVRKGP WLEEEDNQLA AAVAVLGDKR WDALAKASGL RRSGKSCRLR WMNYLRPNLK 60 HGNISVEEER IIIDLHQKWG NRWSKIARRL PGRTDNEIKN YWRSHSKKKA PVMDKECTKN 120 TSLRSECATT TPIKSDIFDA TTSPYEARLT DWMSNWPPDD SLDSKLYSPE WSSTTWDISL 180 WDGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 6e-26 | 5 | 110 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF059374 | 0.0 | KF059374.1 Salvia miltiorrhiza MYB-related transcription factor (MYB20) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011094730.1 | 5e-87 | transcription factor MYB27 | ||||
Swissprot | Q9SCP1 | 1e-53 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A059PRR2 | 1e-132 | A0A059PRR2_SALMI; MYB-related transcription factor | ||||
STRING | Migut.J00446.1.p | 2e-82 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 4e-56 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|