PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00017985-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 108aa MW: 12736.5 Da PI: 8.3151 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.8 | 2.8e-09 | 20 | 56 | 1 | 37 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 +g+WT+eEd++l +v+q+ +W + ++ g+ R++ SMil_00017985-RA_Salv 20 KGAWTQEEDDKLRAYVEQYSHCNWPLLPKFAGLDRCE 56 79***************************99999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.7E-11 | 13 | 58 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.72E-8 | 15 | 58 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.539 | 15 | 58 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 1.0E-6 | 20 | 58 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.40E-4 | 22 | 58 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
LIQGENMVKG TYVDKNGVRK GAWTQEEDDK LRAYVEQYSH CNWPLLPKFA GLDRCELQTA 60 MDELLETRPQ TRDIGLYPRR RRSYCKTSSA IWKQVSHYDH VVCKVTWE |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015571043.1 | 9e-19 | transcription factor MYB4-like | ||||
STRING | Lus10018518 | 7e-20 | (Linum usitatissimum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G16770.2 | 4e-13 | myb domain protein 9 |