PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017960-RA_Salv
Common NameMYB32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family MYB
Protein Properties Length: 257aa    MW: 28716.6 Da    PI: 7.9584
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017960-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.68e-20550147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
  SMil_00017960-RA_Salv  5 KGPWSPEEDDLLQRLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 50
                           79******************************.***********985 PP

2Myb_DNA-binding54.33.1e-1759101347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  SMil_00017960-RA_Salv  59 AFTAEEDDTIIKAHAKFGNK-WATIARFLS-GRTDNAIKNHWNST 101
                            79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.822155IPR017930Myb domain
SuperFamilySSF466891.19E-32298IPR009057Homeodomain-like
SMARTSM007176.2E-18453IPR001005SANT/Myb domain
PfamPF002496.9E-20550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-27658IPR009057Homeodomain-like
CDDcd001671.59E-17749No hitNo description
SMARTSM007171.0E-1456104IPR001005SANT/Myb domain
PROSITE profilePS5129421.12957106IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2359105IPR009057Homeodomain-like
CDDcd001671.74E-1259102No hitNo description
PfamPF002491.7E-1459101IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDRIKGPWSP EEDDLLQRLV EKHGPRNWSL ISKSIPGRSG KSCRLRWCNQ LSPQVEHRAF  60
TAEEDDTIIK AHAKFGNKWA TIARFLSGRT DNAIKNHWNS TLKRKCFSMS EELTDFDPEV  120
HHPLKRSASA GPPGSAFCFN PGSPSGSDDS GHSAHPVYRP VARPAPQPHI VTSLSLSLPG  180
TEPAPAVMDP DPDPQPRWAA EKQFFSAEFL GVMQEIIRKE VRNYMVGMEM EHKGQCMQSD  240
AMMINGVIKQ MGMSKVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-3941063105C-Myb DNA-Binding Domain
1msf_C1e-3941063105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0593860.0KF059386.1 Salvia miltiorrhiza MYB-related transcription factor (MYB32) mRNA, complete cds.
GenBankKF0594960.0KF059496.1 Salvia miltiorrhiza MYB-related transcription factor (MYB32) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851720.11e-128PREDICTED: transcription factor MYB44-like
SwissprotO231606e-83MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A059PRQ30.0A0A059PRQ3_SALMI; MYB-related transcription factor
STRINGMigut.C00524.1.p1e-127(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-76myb domain protein 73
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Li C,Lu S
    Genome-wide characterization and comparative analysis of R2R3-MYB transcription factors shows the complexity of MYB-associated regulatory networks in Salvia miltiorrhiza.
    BMC Genomics, 2014. 15: p. 277
    [PMID:24725266]