Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GRAS | 318.5 | 1.4e-97 | 50 | 419 | 3 | 374 |
GRAS 3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90
+lL +cA a+s++d +++++lL+ l+elasp+gd+ q+laayf++AL + ++s+ ++yk+l + ++++++ +++ + f+evsP+
SMil_00017304-RA_Salv 50 RLLRDCAAAMSDKDSAKIHHLLWMLNELASPYGDTDQKLAAYFLQALFCKATDSGRRCYKTLISVTERSHSFDSARKLILKFQEVSPW 137
6899**********************************************************8888875554444444445******* PP
GRAS 91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
+f+h++ N a lea+ege +H+iD++ + ++QWp+Ll+aLa+R++++p+lR+T+v++ ++ k +++e++ r++kfA+ +gvpfe
SMil_00017304-RA_Salv 138 TTFGHVASNGATLEALEGEPSLHVIDISNTLCTQWPTLLEALATRTDDTPRLRLTVVAA-TAAAKSAMKEIAPRMEKFARLMGVPFEL 224
**********************************************************9.6679************************ PP
GRAS 179 nvl.vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflealey 263
+v+ +rl dl+ ++L+v++gEa+aVn+v +l r+ +e+ r++v++++ksl+Pkvv++ve+ead n+e+F++ f e+l++
SMil_00017304-RA_Salv 225 TVIaGLNRLGDLTKDDLAVREGEAVAVNCVGALRRVD-----VEE-RNRVIETIKSLNPKVVTIVEEEADFssNREDFVKCFEECLRF 306
**95556***************************996.....444.789*******************99877999************ PP
GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegae...rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
+++ f++le++++++s+e+ ++Ere +r+iv v+ac + er+e+ ++W+erl+eaGF++++ s+++++++++ll+++ g
SMil_00017304-RA_Salv 307 HTVYFEMLEESFAPTSNEKLMLERE-CARSIVRVLACDDKVedcDSERREKGRQWSERLREAGFTAAAHSDDVVDDVRALLKRYR-AG 392
*************************.79*********876423468***************************************.77 PP
GRAS 349 yrve.eesgslvlgWkdrpLvsvSaWr 374
+++ ++ ++l Wk++p+v++S+W+
SMil_00017304-RA_Salv 393 WSLLlPGEDGIYLAWKEEPVVWASVWK 419
777625577788**************8 PP
|
Publications
? help Back to Top |
- Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Muraro D, et al.
Integration of hormonal signaling networks and mobile microRNAs is required for vascular patterning in Arabidopsis roots. Proc. Natl. Acad. Sci. U.S.A., 2014. 111(2): p. 857-62 [PMID:24381155] - Tian H,Jia Y,Niu T,Yu Q,Ding Z
The key players of the primary root growth and development also function in lateral roots in Arabidopsis. Plant Cell Rep., 2014. 33(5): p. 745-53 [PMID:24504658] - Gao X,Wang C,Cui H
Identification of bundle sheath cell fate factors provides new tools for C3-to-C4 engineering. Plant Signal Behav, 2018. [PMID:24819776] - Ahrazem O, et al.
Ectopic expression of a stress-inducible glycosyltransferase from saffron enhances salt and oxidative stress tolerance in Arabidopsis while alters anchor root formation. Plant Sci., 2015. 234: p. 60-73 [PMID:25804810] - Jia Y, et al.
The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development. J. Exp. Bot., 2015. 66(15): p. 4631-42 [PMID:25998905] - Zhang M, et al.
A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis. Plant J., 2015. 83(4): p. 582-99 [PMID:26072661] - Moreno-Risueno MA, et al.
Transcriptional control of tissue formation throughout root development. Science, 2015. 350(6259): p. 426-30 [PMID:26494755] - Miguel A,Milhinhos A,Novák O,Jones B,Miguel CM
The SHORT-ROOT-like gene PtSHR2B is involved in Populus phellogen activity. J. Exp. Bot., 2016. 67(5): p. 1545-55 [PMID:26709311] - Gong X, et al.
SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root. Plant Physiol., 2016. 170(3): p. 1675-83 [PMID:26818732] - Kim ES, et al.
HAWAIIAN SKIRT regulates the quiescent center-independent meristem activity in Arabidopsis roots. Physiol Plant, 2016. 157(2): p. 221-33 [PMID:26968317] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] - Li Q,Zhao Y,Yue M,Xue Y,Bao S
The Protein Arginine Methylase 5 (PRMT5/SKB1) Gene Is Required for the Maintenance of Root Stem Cells in Response to DNA Damage. J Genet Genomics, 2016. 43(4): p. 187-97 [PMID:27090604] - Clark NM, et al.
Tracking transcription factor mobility and interaction in Arabidopsis roots with fluorescence correlation spectroscopy. Elife, 2017. [PMID:27288545] - Yoon EK, et al.
Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots. Mol Plant, 2016. 9(8): p. 1197-1209 [PMID:27353361] - Waszczak C, et al.
SHORT-ROOT Deficiency Alleviates the Cell Death Phenotype of the Arabidopsis catalase2 Mutant under Photorespiration-Promoting Conditions. Plant Cell, 2016. 28(8): p. 1844-59 [PMID:27432873] - Yu Q, et al.
A P-Loop NTPase Regulates Quiescent Center Cell Division and Distal Stem Cell Identity through the Regulation of ROS Homeostasis in Arabidopsis Root. PLoS Genet., 2016. 12(9): p. e1006175 [PMID:27583367] - Sparks EE, et al.
Establishment of Expression in the SHORTROOT-SCARECROW Transcriptional Cascade through Opposing Activities of Both Activators and Repressors. Dev. Cell, 2016. 39(5): p. 585-596 [PMID:27923776] - Hirano Y, et al.
Structure of the SHR-SCR heterodimer bound to the BIRD/IDD transcriptional factor JKD. Nat Plants, 2017. 3: p. 17010 [PMID:28211915] - Henry S, et al.
SHR overexpression induces the formation of supernumerary cell layers with cortex cell identity in rice. Dev. Biol., 2017. 425(1): p. 1-7 [PMID:28263767] - Möller BK, et al.
Auxin response cell-autonomously controls ground tissue initiation in the early Arabidopsis embryo. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(12): p. E2533-E2539 [PMID:28265057] - Kobayashi A,Miura S,Kozaki A
INDETERMINATE DOMAIN PROTEIN binding sequences in the 5'-untranslated region and promoter of the SCARECROW gene play crucial and distinct roles in regulating SCARECROW expression in roots and leaves. Plant Mol. Biol., 2017. 94(1-2): p. 1-13 [PMID:28324206] - Díaz-Triviño S,Long Y,Scheres B,Blilou I
Analysis of a Plant Transcriptional Regulatory Network Using Transient Expression Systems. Methods Mol. Biol., 2017. 1629: p. 83-103 [PMID:28623581] - Long Y, et al.
In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots. Nature, 2017. 548(7665): p. 97-102 [PMID:28746306] - Yu Q, et al.
Cell-Fate Specification in Arabidopsis Roots Requires Coordinative Action of Lineage Instruction and Positional Reprogramming. Plant Physiol., 2017. 175(2): p. 816-827 [PMID:28821591] - Spiegelman Z,Lee CM,Gallagher KL
KinG Is a Plant-Specific Kinesin That Regulates Both Intra- and Intercellular Movement of SHORT-ROOT. Plant Physiol., 2018. 176(1): p. 392-405 [PMID:29122988] - Bustillo-Avendaño E, et al.
Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938]
|