PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00015504-RA_Salv

Common Name

MYB66

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

MYB

Protein Properties

Length: 206aa MW: 23725.9 Da PI: 10.187

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00015504-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	45.3	2.1e-14	19	66	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l ++ ++G +W++ ++ g+ R++k+c++rw +yl SMil_00015504-RA_Salv 19 KGAWSEEEDNKLRSYIVRYGHWNWRLLPKFAGLQRCGKSCRLRWMNYL 66 79****************99**********************97 PP
2	Myb_DNA-binding	50.1	6.2e-16	72	116	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg + +eE +l+++++++lG++ W+ Ia++++ gRt++++k++w + SMil_00015504-RA_Salv 72 RGEFNQEEKDLIAKLHQELGNK-WSGIAAKLP-GRTDNDIKNYWMTN 116 899*****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.1E-21	12	69	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.042	14	70	IPR017930	Myb domain
SuperFamily	SSF46689	1.17E-28	16	113	IPR009057	Homeodomain-like
SMART	SM00717	2.8E-10	18	68	IPR001005	SANT/Myb domain
Pfam	PF00249	3.5E-13	19	66	IPR001005	SANT/Myb domain
CDD	cd00167	1.21E-7	21	66	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.0E-23	70	119	IPR009057	Homeodomain-like
SMART	SM00717	4.8E-14	71	119	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	17.129	71	121	IPR017930	Myb domain
Pfam	PF00249	1.5E-14	72	116	IPR001005	SANT/Myb domain
CDD	cd00167	1.76E-8	74	117	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 206 aa Download sequence Send to blast
LCRIKMVKAA YVDKDGLKKG AWSEEEDNKL RSYIVRYGHW NWRLLPKFAG LQRCGKSCRL 60 RWMNYLKPGV KRGEFNQEEK DLIAKLHQEL GNKWSGIAAK LPGRTDNDIK NYWMTNLQKR 120 DKSNKSTEIS DEEKSSNNRK KIEKSSARSD VTSVDPKSCS RKSEKSKVSN SEMFILESSN 180 SNSSVVLNAF KWDLNLSVEQ NGLETL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-24	17	120	5	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF059420	0.0	KF059420.1 Salvia miltiorrhiza MYB-related transcription factor (MYB66) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011091328.1	1e-68	myb-related protein Myb4-like
Swissprot	Q9LTC4	6e-52	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A059PRK2	1e-144	A0A059PRK2_SALMI; MYB-related transcription factor
STRING	Migut.M00365.1.p	2e-64	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	1e-53	myb domain protein 15

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li C,Lu S Genome-wide characterization and comparative analysis of R2R3-MYB transcription factors shows the complexity of MYB-associated regulatory networks in Salvia miltiorrhiza. BMC Genomics, 2014. 15: p. 277 [PMID:24725266] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]