PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013392-RA_Salv
Common NameMYB7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family MYB
Protein Properties Length: 317aa    MW: 34718.3 Da    PI: 8.0248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013392-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.71.7e-201156147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
  SMil_00013392-RA_Salv 11 KGPWSPEEDELLQKLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 56
                           79******************************.***********985 PP

2Myb_DNA-binding55.61.2e-1765107347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  SMil_00013392-RA_Salv  65 AFTPEEDETIIRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 107
                            79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.716661IPR017930Myb domain
SuperFamilySSF466892.29E-328104IPR009057Homeodomain-like
SMARTSM007172.0E-181059IPR001005SANT/Myb domain
PfamPF002494.0E-201156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-271264IPR009057Homeodomain-like
CDDcd001671.12E-171355No hitNo description
SMARTSM007171.2E-1462110IPR001005SANT/Myb domain
PROSITE profilePS5129421.22963112IPR017930Myb domain
PfamPF002497.0E-1565107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2365111IPR009057Homeodomain-like
CDDcd001674.54E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAARSEADRI KGPWSPEEDE LLQKLVEKHG PRNWSLISKS IPGRSGKSCR LRWCNQLSPQ  60
VEHRAFTPEE DETIIRAHAR FGNKWATIAR LLSGRTDNAI KNHWNSTLKR KCVSMSEEFN  120
DFDPEARQPL KRSASVGPGT NISASGFYFN PGSPDGSDMS DSSHSGHLVY RPIARTGGIS  180
PPDPLPDPVT SLSLSLPGFD PSQSPSADVS ARSVLELDPQ IVVDPPVLPQ HSIQMLASHP  240
PPPPPPPAAP AAVQTHQFAA AAADKQFFSA EFLAVMQDMV RKEVRNYMAG IEQKGFCMQS  300
EAIRNAVVKR MGISKID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-41101113104MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-42101113104C-Myb DNA-Binding Domain
1msf_C8e-42101113104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0593610.0KF059361.1 Salvia miltiorrhiza MYB-related transcription factor (MYB7) mRNA, complete cds.
GenBankKF0594710.0KF059471.1 Salvia miltiorrhiza MYB-related transcription factor (MYB7) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851720.11e-168PREDICTED: transcription factor MYB44-like
SwissprotO231601e-94MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A059PRP00.0A0A059PRP0_SALMI; MYB-related transcription factor
STRINGMigut.C00524.1.p1e-167(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-82myb domain protein 73
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Li C,Lu S
    Genome-wide characterization and comparative analysis of R2R3-MYB transcription factors shows the complexity of MYB-associated regulatory networks in Salvia miltiorrhiza.
    BMC Genomics, 2014. 15: p. 277
    [PMID:24725266]