PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00012845-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 198aa MW: 21945.1 Da PI: 9.6756 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 185.3 | 3.3e-57 | 21 | 162 | 20 | 170 |
YABBY 20 til.avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee..lleelkveeenlksnvekeesastsvsseklsen 104 t+l +v vP tslfk+vtvrCGhC++llsvn ++ ll++ +hl +sl + llee +++ +nl +n + + SMil_00012845-RA_Salv 21 TVLsVVGVPCTSLFKTVTVRCGHCSNLLSVN--MRGSLLPSPNHLAHSLFSPhnLLEEIRNAPSNLVMNPN----DPSFLPR------ 96 6663689**********************65..66789********9986553578888887777765543....2223333...... PP YABBY 105 edeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 e +e+p++p + rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl SMil_00012845-RA_Salv 97 EMDELPKPPAAKRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 162 45789**99*******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 5.9E-57 | 21 | 162 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 2.23E-8 | 104 | 155 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.2E-4 | 110 | 154 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
LKFAANNQPP PENRSFRSAA TVLSVVGVPC TSLFKTVTVR CGHCSNLLSV NMRGSLLPSP 60 NHLAHSLFSP HNLLEEIRNA PSNLVMNPND PSFLPREMDE LPKPPAAKRP PEKRQRVPSA 120 YNRFIKDEIQ RIKAGNPDIS HREAFSAAAK NWAHFPHIHF GLMPDQPVKK PNVCQQEGDE 180 ILMKDGFLAS ANIGVSPY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY451396 | 7e-77 | AY451396.1 Antirrhinum majus YABBY-like transcription factor GRAMINIFOLIA (GRAM) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011090395.1 | 1e-104 | axial regulator YABBY 1 | ||||
Swissprot | O22152 | 1e-75 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A2G9G6A7 | 1e-101 | A0A2G9G6A7_9LAMI; Uncharacterized protein | ||||
TrEMBL | Q6SS00 | 1e-101 | Q6SS00_ANTMA; YABBY-like transcription factor GRAMINIFOLIA | ||||
STRING | XP_009793076.1 | 6e-97 | (Nicotiana sylvestris) | ||||
STRING | XP_009609785.1 | 7e-97 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 1e-68 | YABBY family protein |