PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012335-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRAS
Protein Properties Length: 422aa    MW: 47556.9 Da    PI: 6.6708
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012335-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.35e-137104191374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lLl+cA++v++g+  +a++ L  + +lasp+gd+mqR+aayfteALa r+++ +++l kal++++ s    +eel ++klf+e++
  SMil_00012335-RA_Salv  10 LIHLLLACANHVAAGSVDNANTGLDYITHLASPNGDTMQRIAAYFTEALADRMLKGWPGLHKALNSTRMS--FAAEELLVQKLFFELC 95 
                            689*************************************************************999987..599************* PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P+lk+s++++NqaIlea+ege+ vHiiD+   +++QW++L+qaL++Rpegpp+lRiTg+++    +k  l ++++rL++ Ae+l++pf
  SMil_00012335-RA_Salv  96 PFLKLSYVITNQAILEAMEGEKVVHIIDLHCFEPAQWISLIQALSTRPEGPPHLRITGIHR----EKAVLDQMAHRLNEEAEKLDIPF 179
                            *************************************************************....99********************* PP

                   GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrll..........................................desvsles 222
                            +f++ v++ le+l++  Lrvk+gEa+a+++vlqlh+ll                                          ++++ l++
  SMil_00012335-RA_Salv 180 QFHP-VVTPLESLDVGCLRVKTGEAVAISSVLQLHSLLafddelsrspngvllqralhlnprtlsdfldkdataspdsasSSPMLLPK 266
                            ****.79********************************************************************9997644444544 PP

                   GRAS 223 .erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerh 309
                             + + +L+++++lsPk++vv+eqe++hn++s++er++eal++y+alfd+le++ p++s er+k+E +l grei+n++aceg err+rh
  SMil_00012335-RA_Salv 267 sKMEGFLNALWGLSPKLMVVTEQESNHNRASLMERMMEALNFYAALFDCLESTGPSASVERQKIESMLYGREIKNIIACEGVERRARH 354
                            58899*********************************************************************************** PP

                   GRAS 310 etlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            e+le+W  rle+aGF++v ls+++++qa++ll+ ++ dgy+v++e+g++v++W+d+pL+svSaWr
  SMil_00012335-RA_Salv 355 EKLERWIPRLESAGFGKVCLSYHVMMQARRLLQSYNYDGYKVKDENGCFVMCWQDQPLFSVSAWR 419
                            ****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576117No hitNo description
PROSITE profilePS5098559.8511399IPR005202Transcription factor GRAS
PfamPF035141.7E-13410419IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MKSEERGLCL IHLLLACANH VAAGSVDNAN TGLDYITHLA SPNGDTMQRI AAYFTEALAD  60
RMLKGWPGLH KALNSTRMSF AAEELLVQKL FFELCPFLKL SYVITNQAIL EAMEGEKVVH  120
IIDLHCFEPA QWISLIQALS TRPEGPPHLR ITGIHREKAV LDQMAHRLNE EAEKLDIPFQ  180
FHPVVTPLES LDVGCLRVKT GEAVAISSVL QLHSLLAFDD ELSRSPNGVL LQRALHLNPR  240
TLSDFLDKDA TASPDSASSS PMLLPKSKME GFLNALWGLS PKLMVVTEQE SNHNRASLME  300
RMMEALNFYA ALFDCLESTG PSASVERQKI ESMLYGREIK NIIACEGVER RARHEKLERW  360
IPRLESAGFG KVCLSYHVMM QARRLLQSYN YDGYKVKDEN GCFVMCWQDQ PLFSVSAWRF  420
RR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A7e-65242111381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022860767.10.0scarecrow-like protein 3 isoform X1
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A4D8Z2E30.0A0A4D8Z2E3_SALSN; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]