PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012314-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family STAT
Protein Properties Length: 887aa    MW: 100368 Da    PI: 6.5291
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012314-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT187.61.4e-583995181120
                   STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfe 88 
                            ldvvll+a+g  v+k++evvasLlyad+g++ve++ dae+pLL+++dG+e++s++r +kl++GrasfklkisqLsskcdnrLfri+f+
  SMil_00012314-RA_Salv 399 LDVVLLDAFGGHVNKELEVVASLLYADNGVPVENTTDAEPPLLMNCDGIEYASHNRLCKLINGRASFKLKISQLSSKCDNRLFRIMFD 486
                            8*************************************************************************************** PP

                   STAT  89 ipklkkypfleavskpirCisrsrntrssslt 120
                            +p l kypfl ++s pirC+srsrntr++s t
  SMil_00012314-RA_Salv 487 VPGLGKYPFLGTLSLPIRCVSRSRNTRTASIT 518
                            ***************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498999.18E-5133270IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.101.1E-6787842IPR000980SH2 domain
SuperFamilySSF555503.37E-8789855IPR000980SH2 domain
PROSITE profilePS5000110.834789846IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 887 aa     Download sequence    Send to blast
LGRMSDFSGV EEKDYVSLKN LKVEFRRDDD AEEADGCFAL CFWIYIDSCV SFPSSILVQK  60
HPDVTCNMPF LYLDDKKKMK LFPLLFMHKE APIPDNPTPS TEIPCASTEI EFPMKKWVHV  120
GCEVFVLLVG RRSKDYVSLK NLKVEFRRDD DAEEADGCFA LCFWIYIDSC VSFPSSILVQ  180
KHPDVTCNMP FLYLDDKKKM KLFPLLFMHK EAPIPDNPTP STEIPCASTE IEFPMKKWVH  240
VGCEVLRDLM RLHVDGEIVG ENPLTCSFNK DLHTEGLKRL CLACPDENED ILHGYVHGLD  300
IMFRKPAIKN HYVKDPPLQL SIDHSSASEI EEDSDGVWSI VGGKPLVSKF IFLELKLLTL  360
SHALGCNLHQ CLRMRNEAQR DRNSFLNGLK ASCRRIFSLD VVLLDAFGGH VNKELEVVAS  420
LLYADNGVPV ENTTDAEPPL LMNCDGIEYA SHNRLCKLIN GRASFKLKIS QLSSKCDNRL  480
FRIMFDVPGL GKYPFLGTLS LPIRCVSRSR NTRTASITLR KSSNRTYYGN GCESPSPDDG  540
SMQLITNIVR EAKPSPSSKR IKLGQDVPFV MFKEEVSQAN KVHHSHGWTA NQDNAHAMSM  600
KRKPEDHCGT ENNSCASDNS EATNSDPRSM LSVSSPISDL IIFKYCLGGP TEKWHLLKEI  660
AISATEEQLT HFEKQVSLFS GCLHHRHQIK MAKRLVEEGI QAWTSVSGNN HHVLWENLAF  720
SINEQFMKIA CSTRPLMDQD LECLRRITGC RDAVLQEGFE RMWSWLFPVA FTLSQSAVNA  780
MWDSMSPIWI EGFITKEEAE SSLQGPGGLQ DPGTFLLRFP TSRSWPHPDA GNLVVTYVDN  840
DYTIRHRLLS FDFIHSSPSK ETSVKPLQDL LLQEPKLSRL GRVIRSE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082815.10.0uncharacterized protein LOC105165486
TrEMBLA0A4D8Z7X70.0A0A4D8Z7X7_SALSN; Uncharacterized protein
STRINGMigut.M00685.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B