PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00012266-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 130aa MW: 14491.4 Da PI: 4.923 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 168.4 | 8.7e-53 | 1 | 93 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +++q+r++Pianvsrimkk lP nakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGf++yveplk yl+ y SMil_00012266-RA_Salv 1 MKDQERVVPIANVSRIMKKSLPPNAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFQNYVEPLKDYLTTY 90 589*************************************************************************************** PP NF-YB 91 rel 93 r++ SMil_00012266-RA_Salv 91 RDT 93 *97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-48 | 2 | 95 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.57E-36 | 4 | 97 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.4E-27 | 8 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-19 | 35 | 53 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 38 | 54 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-19 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 1.8E-19 | 73 | 91 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MKDQERVVPI ANVSRIMKKS LPPNAKISKE AKETVQECVS EFISFVTGEA SDKCQREKRK 60 TINGDDLLWA MTTLGFQNYV EPLKDYLTTY RDTSPIDDQT KIATANPSFL QGFSSDGGGV 120 VIEFATSSWC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-45 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-45 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021887454.1 | 5e-56 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O23310 | 5e-53 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A2P6RRA0 | 7e-53 | A0A2P6RRA0_ROSCH; Putative transcription factor Hap3/NF-YB family | ||||
TrEMBL | A0A314Y796 | 1e-52 | A0A314Y796_PRUYE; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A4D9AZ56 | 3e-53 | A0A4D9AZ56_SALSN; Uncharacterized protein | ||||
STRING | evm.model.supercontig_196.1 | 2e-55 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-55 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|