PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00012264-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

NF-YB

Protein Properties

Length: 131aa MW: 14614.6 Da PI: 7.1857

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00012264-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	168.9	5.9e-53	1	94	1	94
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +++q+r++Pianvsrimkk lP nakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGf++yv+plk yl+ y SMil_00012264-RA_Salv 1 MKDQERVVPIANVSRIMKKSLPPNAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFQNYVDPLKDYLTTY 90 589*************************************************************************************** PP NF-YB 91 rele 94 r++ SMil_00012264-RA_Salv 91 RDTS 94 *975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	7.2E-48	2	95	IPR009072	Histone-fold
SuperFamily	SSF47113	8.69E-36	4	93	IPR009072	Histone-fold
Pfam	PF00808	5.5E-27	8	71	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	9.2E-19	35	53	No hit	No description
PROSITE pattern	PS00685	0	38	54	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	9.2E-19	54	72	No hit	No description
PRINTS	PR00615	9.2E-19	73	91	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
MKDQERVVPI ANVSRIMKKS LPPNAKISKE AKETVQECVS EFISFVTGEA SDKCQREKRK 60 TINGDDLLWA MTTLGFQNYV DPLKDYLTTY RDTSSPIHDK TKIATANPSF LQGFTSDAGG 120 VVIEFATSSW C

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-45	1	92	1	92	Transcription factor HapC (Eurofung)
4g92_B	2e-45	1	92	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProt	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269\|PubMed:20566706, ECO:0000269\|PubMed:21148627}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269\|PubMed:26542958}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021887454.1	5e-56	nuclear transcription factor Y subunit B-1-like
Swissprot	O23310	2e-52	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q0J7P4	2e-51	HD5_ORYSJ; Nuclear transcription factor Y subunit B-11
Swissprot	Q75IZ7	3e-52	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A2P6RRA0	4e-53	A0A2P6RRA0_ROSCH; Putative transcription factor Hap3/NF-YB family
TrEMBL	A0A4D9AZ56	9e-54	A0A4D9AZ56_SALSN; Uncharacterized protein
STRING	evm.model.supercontig_196.1	2e-55	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	7e-55	nuclear factor Y, subunit B3

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yan WH, et al. A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice. Mol Plant, 2011. 4(2): p. 319-30 [PMID:21148627] Dai X, et al. LHD1, an allele of DTH8/Ghd8, controls late heading date in common wild rice (Oryza rufipogon). J Integr Plant Biol, 2012. 54(10): p. 790-9 [PMID:22963226] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]