PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00008070-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 176aa MW: 19203.6 Da PI: 6.5387 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.6 | 9.9e-55 | 20 | 113 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 vre+drflPian++rimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfe+y++plkvyl+ SMil_00008070-RA_Salv 20 VREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEEYIAPLKVYLA 107 589************************************************************************************* PP NF-YB 89 kyrele 94 +yre + SMil_00008070-RA_Salv 108 RYREGD 113 ***965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.4E-51 | 17 | 120 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.3E-37 | 24 | 116 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-28 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.2E-20 | 54 | 72 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 57 | 73 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.2E-20 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 8.2E-20 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MADSPGGADG GGDQSPPSNV REHDRFLPIA NIGRIMKKAL PANGKIAKDA KDTVQECVSE 60 FISFITSEAS DKCQKEKRKT VNGDDLLWAM ATLGFEEYIA PLKVYLARYR EGDAKGPARG 120 ADGLSAKKEM TGPQLGSDAQ SRTQFGWLSH EAKSRDELFI SGYSGQFKLV DVREIF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-45 | 20 | 111 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 20 | 111 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011077038.1 | 6e-78 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_020548913.1 | 6e-78 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q8VYK4 | 2e-65 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0N6X6V5 | 7e-76 | A0A0N6X6V5_SALMI; Transcription factor NFYB | ||||
STRING | VIT_13s0019g03600.t01 | 4e-73 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 2e-64 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|