PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00005819-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 178aa MW: 19029.3 Da PI: 6.7884 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.1 | 4.5e-57 | 25 | 122 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 vreqdrflPian++rimkk lP+n+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy++plkvyl+ SMil_00005819-RA_Salv 25 VREQDRFLPIANIGRIMKKGLPQNGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIAPLKVYLA 112 69************************************************************************************** PP NF-YB 89 kyrelegekk 98 +yreleg++k SMil_00005819-RA_Salv 113 RYRELEGDTK 122 *******975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.3E-52 | 21 | 130 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.16E-39 | 28 | 130 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.4E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.4E-20 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.4E-20 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 6.4E-20 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MADSPGGHGS HDNGGGGDHS PQSSVREQDR FLPIANIGRI MKKGLPQNGK IAKDAKDTVQ 60 ECVSEFISFV TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIAPLKVY LARYRELEGD 120 TKGSARGADG APKRDTVGTQ LGSDAQALLL KASATLTPKS NINSFLAESV SGYNVQLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-47 | 24 | 116 | 1 | 93 | NF-YB |
4awl_B | 1e-47 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-47 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ418479 | 0.0 | DQ418479.1 Salvia miltiorrhiza transcription factory NF-YB mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011077038.1 | 3e-85 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_020548913.1 | 3e-85 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q8VYK4 | 3e-75 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | Q1W9Y2 | 1e-108 | Q1W9Y2_SALMI; Transcription factory NF-YB | ||||
STRING | POPTR_0008s04440.1 | 5e-78 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-70 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|