PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00005564-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 219aa MW: 24560.4 Da PI: 6.5064 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.3 | 5.6e-16 | 17 | 63 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+W++ Ed++l++ ++++G +W++ ++ g+ R++k+c++rw +yl SMil_00005564-RA_Salv 17 GPWSPAEDLRLINFIQKHGHSNWRALPKQAGLLRCGKSCRLRWINYL 63 89*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.1 | 1.5e-16 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE+ ++++++ G++ W++Ia++++ gRt++++k+ w+++l SMil_00005564-RA_Salv 69 RGNFTPEEENTIIQLHNSIGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.528 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.79E-30 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-11 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.9E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 17 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.42E-10 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 22.09 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-14 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-15 | 69 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-27 | 71 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.41E-10 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MGGGRAPCCD KTKVRTGPWS PAEDLRLINF IQKHGHSNWR ALPKQAGLLR CGKSCRLRWI 60 NYLRPDVKRG NFTPEEENTI IQLHNSIGNK WSKIASCLPG RTDNEIKNVW NTHLKKRGNC 120 KKKSDDEESS PAEKQAASSV SHSPKHALPE VGDDDDFWHV LAPLLHDDDD DDNNVGAEEV 180 EIGKWLRILE NELGLSGDAQ PEILVDFSAS QSDHHYLGI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 4e-27 | 17 | 117 | 5 | 104 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00249 | DAP | Transfer from AT1G79180 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by UV light (PubMed:9839469). Triggered by salicylic acid and jasmonic acid (PubMed:16463103). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF059391 | 0.0 | KF059391.1 Salvia miltiorrhiza MYB-related transcription factor (MYB37) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022028696.1 | 8e-78 | transcription factor MYB58-like | ||||
Swissprot | Q6R0A6 | 5e-71 | MYB63_ARATH; Transcription factor MYB63 | ||||
TrEMBL | A0A059PRQ7 | 1e-124 | A0A059PRQ7_SALMI; MYB-related transcription factor | ||||
STRING | GLYMA15G41255.1 | 2e-73 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 3e-73 | myb domain protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|