PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00004677-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 136aa MW: 15155.9 Da PI: 9.0493 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 105.4 | 3.2e-33 | 41 | 101 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +e++l+cprC+stntk+CyynnyslsqPryfCk+Crry t+GG+lrnvP G+g+ knk+ss SMil_00004677-RA_Salv 41 NEQTLNCPRCNSTNTKLCYYNNYSLSQPRYFCKTCRRYRTEGGSLRNVPDGSGSCKNKRSS 101 68999****************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-22 | 40 | 99 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.2E-27 | 43 | 99 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 25.332 | 45 | 99 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MNEEGEEVLE LRNLQSTTQT QSSKPSNGGA AAAEKKPWSK NEQTLNCPRC NSTNTKLCYY 60 NNYSLSQPRY FCKTCRRYRT EGGSLRNVPD GSGSCKNKRS SPAPPFILAN KPLPDPNFSP 120 QNPKIQEGHD LNLFGL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022887009.1 | 5e-40 | dof zinc finger protein DOF4.6-like | ||||
Swissprot | Q43385 | 9e-30 | DOF37_ARATH; Dof zinc finger protein DOF3.7 | ||||
TrEMBL | A0A4D8ZWA9 | 8e-44 | A0A4D8ZWA9_SALSN; Uncharacterized protein | ||||
STRING | VIT_16s0098g01420.t01 | 9e-36 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA88 | 24 | 419 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61850.1 | 7e-32 | Dof family protein |