PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00003416-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 271aa MW: 31360.5 Da PI: 7.7728 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175 | 2.2e-54 | 12 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWka 85 +ppGfrFhPtdeel+ +yLkkkv+ +++++ +vi+evd++k+ePwdL++ ++ + ++ewyfFs++dkky+tg+r+nrat++g+Wka SMil_00003416-RA_Salv 12 VPPGFRFHPTDEELLYYYLKKKVSYEPIDF-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKA 98 69****************************.9***************952444443456***************************** PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 tg+dk++ ++++ +g++ktLvfy+grap+g+ktdW+mheyrl SMil_00003416-RA_Salv 99 TGRDKAIQMSNSRRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 141 *****************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-61 | 9 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.792 | 12 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.0E-28 | 13 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003002 | Biological Process | regionalization | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0010455 | Biological Process | positive regulation of cell fate commitment | ||||
GO:0048829 | Biological Process | root cap development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 271 aa Download sequence Send to blast |
MMGGGNNGAL SVPPGFRFHP TDEELLYYYL KKKVSYEPID FDVIREVDLN KLEPWDLKEK 60 CRIGSGPQNE WYFFSHKDKK YPTGTRTNRA TAAGFWKATG RDKAIQMSNS RRIGMRKTLV 120 FYTGRAPHGQ KTDWIMHEYR LDDDTAPPNE IQEDGWVICR VFKKKNLSRG FHADVEQEDP 180 PISFHALQQD TFNSMHLPQL LSPEQAASFI PMAGPSFIHH DKLSGDWSFL DKLLATQHTM 240 DHITKCQQFP HVPDLLPPTQ RFPFSYHDFS K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-51 | 10 | 166 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-51 | 10 | 166 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-51 | 10 | 166 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-51 | 10 | 166 | 15 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swm_B | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swm_C | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swm_D | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swp_A | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swp_B | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swp_C | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
3swp_D | 2e-51 | 10 | 166 | 18 | 170 | NAC domain-containing protein 19 |
4dul_A | 2e-51 | 10 | 166 | 15 | 167 | NAC domain-containing protein 19 |
4dul_B | 2e-51 | 10 | 166 | 15 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00250 | DAP | Transfer from AT1G79580 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095843.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_011095844.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554180.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554181.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554182.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554183.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554184.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554185.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554186.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554187.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554188.1 | 1e-142 | protein SOMBRERO-like | ||||
Refseq | XP_020554189.1 | 1e-142 | protein SOMBRERO-like | ||||
Swissprot | Q9MA17 | 1e-105 | SMB_ARATH; Protein SOMBRERO | ||||
TrEMBL | A0A2G9HTP4 | 1e-147 | A0A2G9HTP4_9LAMI; Uncharacterized protein | ||||
STRING | Migut.M01489.1.p | 1e-131 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA134 | 24 | 297 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79580.3 | 7e-89 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|