PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00003375-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 167aa MW: 18319.4 Da PI: 5.8555 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167.4 | 1.8e-52 | 42 | 138 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 +req+r+lPianv+rimk++lP nakisk+aket+qec+sefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy ++lk yl SMil_00003375-RA_Salv 42 MREQERLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASDKCHKEKRKTVNGDDICWALGSLGFDDYGDSLKRYLV 129 58************************************************************************************** PP NF-YB 89 kyrelegek 97 +yre+ege+ SMil_00003375-RA_Salv 130 RYREAEGER 138 ******997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-50 | 38 | 147 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.83E-38 | 45 | 145 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-27 | 48 | 112 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.9E-17 | 76 | 94 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 79 | 95 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.9E-17 | 95 | 113 | No hit | No description |
PRINTS | PR00615 | 2.9E-17 | 114 | 132 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MVDNIGPNHS SRQRGLRSSY TSYAASVAAV SGGGGDEDEG GMREQERLLP IANVGRIMKQ 60 ILPPNAKISK EAKETMQECA SEFISFVTGE ASDKCHKEKR KTVNGDDICW ALGSLGFDDY 120 GDSLKRYLVR YREAEGERAA NQNKAPAAPD DGGLPFSFDL MEKRRIN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-43 | 42 | 133 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-43 | 42 | 133 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 3e-69 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011079712.1 | 2e-74 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 6e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A4D8YJR5 | 2e-87 | A0A4D8YJR5_SALSN; Uncharacterized protein | ||||
STRING | XP_008368975.1 | 7e-69 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-58 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|