PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00002825-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 62aa MW: 7064.33 Da PI: 4.9116 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 22.9 | 2e-07 | 10 | 41 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g W +eEd+ll ++++ +G g W++++ + g SMil_00002825-RA_Salv 10 KGMWIPEEDDLLRKCIETYGEGKWHLVPIRAG 41 688************************98877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.71E-7 | 6 | 40 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.4E-9 | 7 | 37 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.7E-6 | 10 | 41 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.09E-4 | 13 | 36 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
METNPLGVRK GMWIPEEDDL LRKCIETYGE GKWHLVPIRA GILLSEPITY PPWASITCPP 60 LM |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011073629.1 | 9e-15 | transcription factor MYB114 | ||||
TrEMBL | W8EB73 | 1e-14 | W8EB73_ERYLE; Anthocyanin-activating R2R3 MYB transcription factor | ||||
STRING | Migut.L00458.1.p | 7e-14 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66380.1 | 8e-16 | myb domain protein 114 |