PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00002752-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 179aa MW: 19407.5 Da PI: 5.7623 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.6 | 5.7e-56 | 15 | 110 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 reqdrflPianvsrimk+ lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllw ++tlGfe+yv+plk+yl+k SMil_00002752-RA_Salv 15 REQDRFLPIANVSRIMKRGLPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWGMTTLGFENYVDPLKLYLQK 102 89************************************************************************************** PP NF-YB 90 yrelegek 97 +r++e+ek SMil_00002752-RA_Salv 103 FRDVEEEK 110 *****997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.0E-52 | 10 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.64E-39 | 17 | 126 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.0E-26 | 20 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-20 | 48 | 66 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 51 | 67 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-20 | 67 | 85 | No hit | No description |
PRINTS | PR00615 | 1.3E-20 | 86 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MADSDNESGD HRSPREQDRF LPIANVSRIM KRGLPANAKI SKDAKETVQE CVSEFISFIT 60 GEASDKCQRE KRKTINGDDL LWGMTTLGFE NYVDPLKLYL QKFRDVEEEK TVMAGRRDKD 120 SGGDGDGDAD AGFYGLNVMG HQGGPVYGSY HVGATSGTAA ARRGGGAGRS SRLGSFTCD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 4e-48 | 9 | 105 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095535.1 | 1e-73 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 5e-69 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A4D9BZK5 | 3e-78 | A0A4D9BZK5_SALSN; Uncharacterized protein | ||||
STRING | VIT_19s0015g00440.t01 | 2e-70 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-68 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|