PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00002751-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 174aa MW: 18791.1 Da PI: 8.0435 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.7 | 5.3e-56 | 10 | 105 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 reqdrflPianvsrimk+ lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllw ++tlGfe+yv+plk+yl+k SMil_00002751-RA_Salv 10 REQDRFLPIANVSRIMKRGLPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWGMTTLGFENYVDPLKLYLQK 97 89************************************************************************************** PP NF-YB 90 yrelegek 97 +r++e+ek SMil_00002751-RA_Salv 98 FRDVEEEK 105 *****997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.4E-51 | 10 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-39 | 12 | 121 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-26 | 15 | 77 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-20 | 43 | 61 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 46 | 62 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-20 | 62 | 80 | No hit | No description |
PRINTS | PR00615 | 1.2E-20 | 81 | 99 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MSRGIIGTPR EQDRFLPIAN VSRIMKRGLP ANAKISKDAK ETVQECVSEF ISFITGEASD 60 KCQREKRKTI NGDDLLWGMT TLGFENYVDP LKLYLQKFRD VEEEKTVMAG RRDKDSGGDG 120 DGDADAGFYG LNVMGHQGGP VYGSYHVGAT SGAAAARRGG GAGRSSRLGS FTCD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-47 | 10 | 100 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-47 | 10 | 100 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027930250.1 | 2e-68 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 9e-64 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A4D9BZK5 | 3e-73 | A0A4D9BZK5_SALSN; Uncharacterized protein | ||||
STRING | XP_007142418.1 | 2e-67 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 7e-63 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|