PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00002269-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 155aa MW: 16633.9 Da PI: 8.3702 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144.8 | 2.5e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqle 88 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++r+da++sl+yeAear+rdPvyG+vg i+ lq+q++ SMil_00002269-RA_Salv 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNELLPHQRDDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVD 97 7*************************************************************************************** PP DUF260 89 qlkaelallke 99 +l++el+++++ SMil_00002269-RA_Salv 98 RLQKELDAANA 108 ******99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.569 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.3E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNELLP 60 HQRDDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVDRLQ KELDAANADL IRFACATGIP 120 PSPAPVGPPR QRPGEYSRRI GDGGGGGGGE SHASL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-66 | 9 | 120 | 10 | 123 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-66 | 9 | 120 | 10 | 123 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002318660.1 | 2e-85 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_011047821.1 | 2e-85 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 6e-73 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | B9I3C8 | 5e-84 | B9I3C8_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0012s08540.1 | 8e-85 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 7e-76 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|