PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00001910-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

MYB_related

Protein Properties

Length: 88aa MW: 10258.8 Da PI: 11.2338

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00001910-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.5	5.6e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l v+++G ++W++ ++ g+ R++k+c++rw +yl SMil_00001910-RA_Salv 14 KGAWSKEEDDRLRAQVERFGHNNWRRLPSLAGLARCGKSCRLRWMNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.1E-22	8	70	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.013	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	4.99E-18	9	70	IPR009057	Homeodomain-like
SMART	SM00717	3.0E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.1E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	6.57E-10	16	61	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MVRAPTFDSN GIKKGAWSKE EDDRLRAQVE RFGHNNWRRL PSLAGLARCG KSCRLRWMNY 60 LKPGLKRGKF DLKLKRNTSS NYMINSET

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted. Triggers tolerance to nickel (Ni) and zinc (Zn) ions. {ECO:0000269\|PubMed:24278034}.
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates strongly in the root stele and in the outer layers of the lateral roots when exposed to iron (Fe)-deficient conditions (PubMed:24278034). Slightly induced by ethylene and by darkness conditions (PubMed:9839469). Accumulates upon potassium (K) depletion (PubMed:15489280). Induced by zinc (Zn) and cadmium (Cd) ions (PubMed:18088336). {ECO:0000269\|PubMed:15489280, ECO:0000269\|PubMed:18088336, ECO:0000269\|PubMed:24278034, ECO:0000269\|PubMed:9839469}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF059456	1e-138	KF059456.1 Salvia miltiorrhiza MYB-related transcription factor (MYB102) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011100426.1	1e-35	myb-related protein 308-like
Refseq	XP_015571043.1	8e-36	transcription factor MYB4-like
Swissprot	Q9LTV4	2e-26	MYB10_ARATH; Transcription factor MYB10
Swissprot	Q9LXF1	4e-26	MYB16_ARATH; Transcription factor MYB16
TrEMBL	A0A059PRV4	5e-44	A0A059PRV4_SALMI; MYB-related transcription factor (Fragment)
STRING	Migut.M00366.1.p	4e-33	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G12820.1	1e-28	myb domain protein 10

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]