PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00000944-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 138aa MW: 15401.7 Da PI: 4.656 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 111.4 | 5.1e-35 | 1 | 64 | 38 | 101 |
NF-YC 38 misaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101 misaeaPv++++ace+fileltlr+w+h+eenkrrtl+k+diaaa+trtdifdflvdivpr++l SMil_00000944-RA_Salv 1 MISAEAPVIFARACEMFILELTLRAWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 64 8************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.4E-27 | 1 | 61 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.01E-20 | 1 | 61 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.9E-12 | 2 | 46 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MISAEAPVIF ARACEMFILE LTLRAWNHTE ENKRRTLQKN DIAAAITRTD IFDFLVDIVP 60 REDLKDEVLA SMPRGALPVG APTEGLPYYY MPQQSAPPVG APGMYVGKPV DPGMYGQQSR 120 PYMAQQMWPQ QPPPPPDS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 5e-39 | 1 | 61 | 35 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 33 | 39 | RRTLQKN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027164987.1 | 2e-82 | nuclear transcription factor Y subunit C-9-like isoform X2 | ||||
Swissprot | Q8L4B2 | 3e-56 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
TrEMBL | A0A4D8ZEV4 | 3e-82 | A0A4D8ZEV4_SALSN; Uncharacterized protein | ||||
STRING | POPTR_0010s03730.1 | 7e-79 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3422 | 24 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08970.4 | 1e-56 | nuclear factor Y, subunit C9 |