PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00000751-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRAS
Protein Properties Length: 479aa    MW: 53599.6 Da    PI: 6.2479
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00000751-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS469.71.6e-143484761374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lL++cA++vssg+le+a+ +L ++s+laspdgd+mqR+a+yf eALa r++r ++++yka+++++ s   ++ee++++k+f+e  
  SMil_00000751-RA_Salv  48 LIHLLITCANHVSSGSLENANIALDQISHLASPDGDTMQRIASYFSEALADRILRAWPGVYKAFRSTRIS--VVAEEIHVRKMFFEFL 133
                            689************************************************************9998887..6*************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P++k+++++ NqaI ea+ege++vH+iD+++++++QW aL++ L++Rpegpp+lRiTg+++    ++e le+t++ L + Ae+l++pf
  SMil_00000751-RA_Salv 134 PFMKVAFVISNQAIIEAMEGEKMVHVIDLNATEPTQWCALIRDLSARPEGPPHLRITGIHQ----KREVLEQTAHVLIEEAEKLDLPF 217
                            *************************************************************....9********************** PP

                   GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrll.................................................. 214
                            +fn+ v+++ledl++e+Lrvk+gEala+++++qlh+ll                                                  
  SMil_00000751-RA_Salv 218 QFNP-VVSKLEDLDVEKLRVKTGEALAISSIMQLHTLLasncdaggnrsplapmkgigvhlqraaqmnqgtlgellekdmvngyspst 304
                            ****.799******************************************************************************** PP

                   GRAS 215 ............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                                        +  v+++ ++d  L+++++lsPkv+vv+eq++dhn++s++er++e+l++y+alfd+le+ lpr+s er k+E++l+
  SMil_00000751-RA_Salv 305 dsasssplssmpSPAVPSSPKIDGYLSTLWGLSPKVMVVTEQDSDHNGKSLMERLSESLYFYAALFDCLESALPRASIERLKMEKMLF 392
                            ********9987555555557899**************************************************************** PP

                   GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            g+ei+n++acegaer++rhe+lekW++r+e aGF++vpls++a+ qak+ll+ ++ dgy+++e++g++v++W+drpL+svSaWr
  SMil_00000751-RA_Salv 393 GEEIKNIIACEGAERKQRHERLEKWNQRFELAGFGNVPLSYYAMLQAKRLLQSYNCDGYKIKEDNGCVVICWQDRPLLSVSAWR 476
                            ***********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.78322456IPR005202Transcription factor GRAS
PfamPF035145.6E-14148476IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MFQEDGSSSV TSSPLQMFPM MSSSSPSSLM SPYPWLKDLK PEERGLYLIH LLITCANHVS  60
SGSLENANIA LDQISHLASP DGDTMQRIAS YFSEALADRI LRAWPGVYKA FRSTRISVVA  120
EEIHVRKMFF EFLPFMKVAF VISNQAIIEA MEGEKMVHVI DLNATEPTQW CALIRDLSAR  180
PEGPPHLRIT GIHQKREVLE QTAHVLIEEA EKLDLPFQFN PVVSKLEDLD VEKLRVKTGE  240
ALAISSIMQL HTLLASNCDA GGNRSPLAPM KGIGVHLQRA AQMNQGTLGE LLEKDMVNGY  300
SPSTDSASSS PLSSMPSPAV PSSPKIDGYL STLWGLSPKV MVVTEQDSDH NGKSLMERLS  360
ESLYFYAALF DCLESALPRA SIERLKMEKM LFGEEIKNII ACEGAERKQR HERLEKWNQR  420
FELAGFGNVP LSYYAMLQAK RLLQSYNCDG YKIKEDNGCV VICWQDRPLL SVSAWRNRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-40314781380Protein SCARECROW
5b3h_D3e-40314781380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080382.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A4D9BMD50.0A0A4D9BMD5_SALSN; Uncharacterized protein
STRINGMigut.N02362.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]