PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_28554.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 143aa MW: 15211.3 Da PI: 10.7386 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.7 | 6.3e-09 | 2 | 37 | 12 | 47 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++ + +++G+g+W++I+r + +Rt+ q+ s+ qky Sme2.5_28554.1_g00001.1 2 FLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 37 777899*****************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.706 | 1 | 42 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.14E-10 | 1 | 43 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.52E-6 | 1 | 38 | No hit | No description |
TIGRFAMs | TIGR01557 | 1.7E-11 | 2 | 40 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 7.7E-7 | 2 | 37 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-6 | 2 | 36 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
LFLLGLEKYG KGDWRSISRN FVVTRTPTQV ASHAQKYFIR LNSMNKDRRR TSIHDITSVN 60 SGDVSVPQVP ITGQTIGAGA GGSSGKSIKQ SRAAPIAPVG LGMYGTTTVG QPVAGPLVNV 120 VGQRQIQGLD IMGSSLGFYY DQS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016572400.1 | 2e-85 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q9FNN6 | 2e-48 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A2G2X9C5 | 2e-84 | A0A2G2X9C5_CAPBA; Transcription factor DIVARICATA | ||||
STRING | PGSC0003DMT400065102 | 2e-82 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4149 | 24 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 2e-45 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|