PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_06156.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 299aa    MW: 34705.4 Da    PI: 6.784
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_06156.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.6e-181865148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd  l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Sme2.5_06156.1_g00003.1 18 RGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 65
                             89********************************************97 PP

2Myb_DNA-binding51.42.4e-1671114146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sme2.5_06156.1_g00003.1  71 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 114
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3681365IPR017930Myb domain
SuperFamilySSF466898.24E-3115112IPR009057Homeodomain-like
SMARTSM007175.1E-151767IPR001005SANT/Myb domain
PfamPF002494.6E-161865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-221972IPR009057Homeodomain-like
CDDcd001672.71E-112065No hitNo description
PROSITE profilePS5129423.24666120IPR017930Myb domain
SMARTSM007171.3E-1470118IPR001005SANT/Myb domain
PfamPF002494.9E-1571114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2373119IPR009057Homeodomain-like
CDDcd001675.38E-791114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKNNREIQEE DIGMDLRRGP WTVEEDFTLI NFIAHHGEGR WNSLARCAGL KRTGKSCRLR  60
WLNYLRPDVR RGNITLEEQL LILELHSRWG NRWSKIAQHL PGRTDNEIKN YWRTRVQKHA  120
KQLKCDVNSK QFKDTMKYLW MPRLAERIQA AAATNATAAS SSGPTTTTTT TYIQSQEIQQ  180
PPQNMNHHVS EYIPMNIEKT NILNYSATSA SSDNYSSDLT DGCYNFSISQ SNNQDYSQVN  240
QSTNHLCYGD STINPNDYNF HPGFQGFQEV DQQNNTQWID NTWNIEDVCF LQQQLNNDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24151184106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-162HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075113.10.0transcription factor MYB78
TrEMBLA0A3Q7GN670.0A0A3Q7GN67_SOLLC; Uncharacterized protein
TrEMBLM1CL870.0M1CL87_SOLTU; Uncharacterized protein
STRINGSolyc05g053330.2.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000698410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.18e-85myb domain protein 78