PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_05988.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 10233.7 Da PI: 10.5363 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.8 | 2.9e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++ +G+g+W+ ++ g+ R++k+c++rw +yl Sme2.5_05988.1_g00003.1 14 KGPWTPEEDQKLIQYIQVHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 61 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.3E-27 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.83 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 4.7E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.32E-24 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.05E-13 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.112 | 62 | 88 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MGRTPSSDKN GLKKGPWTPE EDQKLIQYIQ VHGPGNWRNL PKNAGLQRCG KSCRLRWTNY 60 LRPDIRRGRF SFEEEETIIQ LHSVLGNK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-18 | 12 | 88 | 25 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC244721 | 4e-64 | AC244721.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-58o17 map 10, complete sequence. | |||
GenBank | HG975449 | 4e-64 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. | |||
GenBank | HG975522 | 4e-64 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015170575.1 | 2e-60 | PREDICTED: transcription factor MYB39-like | ||||
Swissprot | Q9M0J5 | 5e-53 | MYB41_ARATH; Transcription factor MYB41 | ||||
TrEMBL | M1CJ44 | 6e-59 | M1CJ44_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400068481 | 1e-59 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28110.1 | 2e-55 | myb domain protein 41 |
Publications ? help Back to Top | |||
---|---|---|---|
|