PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03374.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HB-other
Protein Properties Length: 529aa    MW: 59934.1 Da    PI: 6.3738
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03374.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13e-182681257
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             + R   t+ q+e Le+++e+++yp+++++ e A++lgLte+qV+ WF+ rR k+k+
  Sme2.5_03374.1_g00004.1 26 KARIIKTPAQIEGLEKFYEEHKYPTESMKLEVAQSLGLTEKQVSGWFCHRRLKHKR 81
                             678999*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-18881IPR009057Homeodomain-like
SuperFamilySSF466899.84E-171181IPR009057Homeodomain-like
PROSITE profilePS5007115.7262282IPR001356Homeobox domain
SMARTSM003895.0E-192486IPR001356Homeobox domain
PfamPF000467.4E-162681IPR001356Homeobox domain
CDDcd000862.44E-162681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MDDYLSASDS REIHSEDDKG HVGKIKARII KTPAQIEGLE KFYEEHKYPT ESMKLEVAQS  60
LGLTEKQVSG WFCHRRLKHK RLLRRETYAN GRQDRSSGGI QDRGSGYRQD SCGSTKQGDD  120
KYFDHREVES RRLNVPEVSA ADVACDVDTR YKAEPNLMED TLSGSSSSLQ DGSFSQNVES  180
FDVATSRYLP CNEPTDLRCV KPRTGPSGYL KVKRKVENAS VTAVKGQLGS LYRQDGPQLS  240
VVFDPLPQGA FESAVRTLVY DPEYAGEPVP DVTPNFTRVY KQFNSCIGYG SISKTNSHVS  300
DLDGASFKKS NKSAHPEYYV NQKPAWNSSM HNGYHYHLGQ NSSMEMHKDS QRELAVEGKC  360
NYKFMAKHDG AEIKTSPGSS GGFQSPYIGK VNREQVMPRF TSCNNMSLEI AEEENLECKP  420
SNFVRKGSKH RYCPEREHFS EVEKDYIHVE RPAVDENYNE DRVNIPWENE MRAAKRAWDD  480
EAPNHQEYMR KASVTRIISQ TSYQTRSATE MSSSCSEDDK TEDTSSFED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349800.10.0PREDICTED: uncharacterized protein LOC102600158
TrEMBLA0A0V0IK250.0A0A0V0IK25_SOLCH; Putative ovule protein
STRINGSolyc12g099760.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.16e-54HB-other family protein