PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_02949.1_g00006.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 105aa MW: 11757.8 Da PI: 10.6243 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 27.8 | 5.2e-09 | 16 | 93 | 19 | 96 |
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdiv 96 ++P+ ri + lka+ k + +Pv+l a e++++++ + + a++nk++ ++ i+ av + d + l+ +v Sme2.5_02949.1_g00006.1 16 LQFPVGRITRFLKAERYAKYVVVGTPVFLVAALEYLVVKVLEVAGNTARDNKKTQINPRHIQLAVRNDDELNKLLRDV 93 589**************************************************************9998776554333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00414 | 1.9E-32 | 2 | 105 | IPR002119 | Histone H2A |
Gene3D | G3DSA:1.10.20.10 | 7.4E-43 | 4 | 104 | IPR009072 | Histone-fold |
Pfam | PF00125 | 4.6E-11 | 5 | 81 | IPR007125 | Histone H2A/H2B/H3 |
SuperFamily | SSF47113 | 9.63E-32 | 5 | 90 | IPR009072 | Histone-fold |
PRINTS | PR00620 | 6.5E-31 | 6 | 28 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 6.5E-31 | 35 | 50 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 6.5E-31 | 50 | 63 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 6.5E-31 | 64 | 78 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 6.5E-31 | 92 | 105 | IPR002119 | Histone H2A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000786 | Cellular Component | nucleosome | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MAVTKKSCSR STKTGLQFPV GRITRFLKAE RYAKYVVVGT PVFLVAALEY LVVKVLEVAG 60 NTARDNKKTQ INPRHIQLAV RNDDELNKLL RDVFINNGEL SPLIS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5gsu_C | 1e-37 | 6 | 104 | 13 | 111 | Histone H2A type 1-A |
5gsu_G | 1e-37 | 6 | 104 | 13 | 111 | Histone H2A type 1-A |
5gt0_C | 1e-37 | 6 | 104 | 13 | 111 | Histone H2A type 1-A |
5gt0_G | 1e-37 | 6 | 104 | 13 | 111 | Histone H2A type 1-A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022028534.1 | 3e-44 | histone H2A.6 | ||||
Swissprot | O81826 | 9e-45 | H2A3_ARATH; Probable histone H2A.3 | ||||
TrEMBL | A0A1J3ITE2 | 6e-43 | A0A1J3ITE2_NOCCA; Histone H2A | ||||
STRING | Lus10032464 | 3e-43 | (Linum usitatissimum) | ||||
STRING | Lus10042960 | 3e-43 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA164 | 6 | 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|