| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 168 | 7.6e-52 | 139 | 302 | 1 | 174 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85
l++lLlecA a+s ++l +a++ L +l ++asp+g + +R++ayf++A+a+r+ +s+ ++++ l +++ +a+++f+
Sme2.5_02291.1_g00006.1 139 LITLLLECAVAISVDNLGEAHRKLLELTQMASPYGpSCAERVVAYFAKAMASRVINSWLGICSPLINY-------KSVYSAFQVFN 217
5789*******************************9999**********************9766544.......446899***** PP
GRAS 86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAee 171
++sP++kf+h+t NqaIlea+++++rvHiiD di+qGlQWpaL++ La+R egpp++ +Tg+g s e l etg++L++fA++
Sme2.5_02291.1_g00006.1 218 NISPFIKFAHFTSNQAILEAFHRQDRVHIIDVDIMQGLQWPALFHILATRMEGPPHVTMTGMGT----SMELLIETGKQLSNFAKR 299
****************************************************************....9****************9 PP
GRAS 172 lgv 174
lg+
Sme2.5_02291.1_g00006.1 300 LGM 302
985 PP
|
| 2 | GRAS | 140 | 2.4e-43 | 303 | 471 | 199 | 374 |
GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
g+a+a+++v h+l+d +++ + +++lv+ lsP+vv+++eqe+ + ++sFl+rf+ +l+yys++fdsl a l ++++ r++
Sme2.5_02291.1_g00006.1 303 GDAVAIHWVQ--HSLYDATGPDWK----TMRLVQALSPRVVTLIEQEIAL-GGSFLDRFVGSLHYYSTIFDSLGAFLESDDSSRHS 381
7899999999..999999998888....**********************.789******************************** PP
GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
vE+ ll rei n++a g +r+ + ++++Wr+ l++ GF +vp+s++ ++qa+l+l++++ +gy++ + +g+l lgWkd +L++
Sme2.5_02291.1_g00006.1 382 VEHGLLYREINNILAIGGPARNGE-DKFRHWRSELSKNGFIQVPMSTNSMAQAQLILNMFPpAHGYSLVQGDGTLRLGWKDTSLFA 466
********************7665.55*********************************************************** PP
GRAS 370 vSaWr 374
+S+W+
Sme2.5_02291.1_g00006.1 467 ASVWT 471
****6 PP
|
| Publications
? help Back to Top |
- Liu YG, et al.
Complementation of plant mutants with large genomic DNA fragments by a transformation-competent artificial chromosome vector accelerates positional cloning.
Proc. Natl. Acad. Sci. U.S.A., 1999. 96(11): p. 6535-40
[PMID:10339623] - Ticconi CA, et al.
ER-resident proteins PDR2 and LPR1 mediate the developmental response of root meristems to phosphate availability.
Proc. Natl. Acad. Sci. U.S.A., 2009. 106(33): p. 14174-9
[PMID:19666499] - Moubayidin L, et al.
Spatial coordination between stem cell activity and cell differentiation in the root meristem.
Dev. Cell, 2013. 26(4): p. 405-15
[PMID:23987513] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Tian H,Jia Y,Niu T,Yu Q,Ding Z
The key players of the primary root growth and development also function in lateral roots in Arabidopsis.
Plant Cell Rep., 2014. 33(5): p. 745-53
[PMID:24504658] - Reyes-Hernández BJ, et al.
The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana.
New Phytol., 2014. 202(4): p. 1223-36
[PMID:24635769] - Gao X,Wang C,Cui H
Identification of bundle sheath cell fate factors provides new tools for C3-to-C4 engineering.
Plant Signal Behav, 2018.
[PMID:24819776] - Ron M, et al.
Hairy root transformation using Agrobacterium rhizogenes as a tool for exploring cell type-specific gene expression and function using tomato as a model.
Plant Physiol., 2014. 166(2): p. 455-69
[PMID:24868032] - Jia Y, et al.
The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development.
J. Exp. Bot., 2015. 66(15): p. 4631-42
[PMID:25998905] - Zhang M, et al.
A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis.
Plant J., 2015. 83(4): p. 582-99
[PMID:26072661] - Moreno-Risueno MA, et al.
Transcriptional control of tissue formation throughout root development.
Science, 2015. 350(6259): p. 426-30
[PMID:26494755] - Gong X, et al.
SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
Plant Physiol., 2016. 170(3): p. 1675-83
[PMID:26818732] - Moubayidin L, et al.
A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis.
Planta, 2016. 243(5): p. 1159-68
[PMID:26848984] - Madmon O, et al.
Expression of MAX2 under SCARECROW promoter enhances the strigolactone/MAX2 dependent response of Arabidopsis roots to low-phosphate conditions.
Planta, 2016. 243(6): p. 1419-27
[PMID:26919985] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
Mol Plant, 2016. 9(6): p. 870-84
[PMID:26970019] - Benfey PN
Defining the Path from Stem Cells to Differentiated Tissue.
Curr. Top. Dev. Biol., 2016. 116: p. 35-43
[PMID:26970612] - Li Q,Zhao Y,Yue M,Xue Y,Bao S
The Protein Arginine Methylase 5 (PRMT5/SKB1) Gene Is Required for the Maintenance of Root Stem Cells in Response to DNA Damage.
J Genet Genomics, 2016. 43(4): p. 187-97
[PMID:27090604] - Clark NM, et al.
Tracking transcription factor mobility and interaction in Arabidopsis roots with fluorescence correlation spectroscopy.
Elife, 2017.
[PMID:27288545] - Choi JW,Lim J
Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
Mol. Cells, 2016. 39(7): p. 524-9
[PMID:27306644] - Yoon EK, et al.
Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
Mol Plant, 2016. 9(8): p. 1197-1209
[PMID:27353361] - Waszczak C, et al.
SHORT-ROOT Deficiency Alleviates the Cell Death Phenotype of the Arabidopsis catalase2 Mutant under Photorespiration-Promoting Conditions.
Plant Cell, 2016. 28(8): p. 1844-59
[PMID:27432873] - Goh T, et al.
Quiescent center initiation in the Arabidopsis lateral root primordia is dependent on the SCARECROW transcription factor.
Development, 2016. 143(18): p. 3363-71
[PMID:27510971] - Yu Q, et al.
A P-Loop NTPase Regulates Quiescent Center Cell Division and Distal Stem Cell Identity through the Regulation of ROS Homeostasis in Arabidopsis Root.
PLoS Genet., 2016. 12(9): p. e1006175
[PMID:27583367] - Sparks EE, et al.
Establishment of Expression in the SHORTROOT-SCARECROW Transcriptional Cascade through Opposing Activities of Both Activators and Repressors.
Dev. Cell, 2016. 39(5): p. 585-596
[PMID:27923776] - Hirano Y, et al.
Structure of the SHR-SCR heterodimer bound to the BIRD/IDD transcriptional factor JKD.
Nat Plants, 2017. 3: p. 17010
[PMID:28211915] - Kobayashi A,Miura S,Kozaki A
INDETERMINATE DOMAIN PROTEIN binding sequences in the 5'-untranslated region and promoter of the SCARECROW gene play crucial and distinct roles in regulating SCARECROW expression in roots and leaves.
Plant Mol. Biol., 2017. 94(1-2): p. 1-13
[PMID:28324206] - Díaz-Triviño S,Long Y,Scheres B,Blilou I
Analysis of a Plant Transcriptional Regulatory Network Using Transient Expression Systems.
Methods Mol. Biol., 2017. 1629: p. 83-103
[PMID:28623581] - Long Y, et al.
In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots.
Nature, 2017. 548(7665): p. 97-102
[PMID:28746306] - Bruno L, et al.
In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk.
Front Plant Sci, 2017. 8: p. 1323
[PMID:28798767] - Mira MM, et al.
Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
J. Exp. Bot., 2017. 68(20): p. 5653-5668
[PMID:29059380] - Bustillo-Avendaño E, et al.
Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
Plant Physiol., 2018. 176(2): p. 1709-1727
[PMID:29233938] - Ercoli MF, et al.
GIF Transcriptional Coregulators Control Root Meristem Homeostasis.
Plant Cell, 2018. 30(2): p. 347-359
[PMID:29352064] - Shimotohno A,Heidstra R,Blilou I,Scheres B
Root stem cell niche organizer specification by molecular convergence of PLETHORA and SCARECROW transcription factor modules.
Genes Dev., 2018. 32(15-16): p. 1085-1100
[PMID:30018102]
|
