PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01096.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 598aa    MW: 65980.2 Da    PI: 6.7816
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01096.1_g00010.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-173986148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Sme2.5_01096.1_g00010.1 39 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 86
                             79******************************************9986 PP

2Myb_DNA-binding23.81.1e-0792120130
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIart 30 
                              +g++T+eE+ +++++++++G++ W++ a++
  Sme2.5_01096.1_g00010.1  92 KGAFTPEEERRIIELHAKMGNK-WARMAAE 120
                              799*******************.***9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1293490IPR017930Myb domain
SMARTSM007171.7E-133888IPR001005SANT/Myb domain
PfamPF002494.7E-153986IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-2440116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-244098IPR009057Homeodomain-like
CDDcd001676.18E-114186No hitNo description
SMARTSM007172.5E-491219IPR001005SANT/Myb domain
PROSITE profilePS512948.5591139IPR017930Myb domain
PfamPF002492.2E-692120IPR001005SANT/Myb domain
SuperFamilySSF466895.81E-592138IPR009057Homeodomain-like
CDDcd001670.0062294120No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1899118IPR009057Homeodomain-like
SuperFamilySSF466895.81E-5189218IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-18199218IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MSMTSGSDDR MASQDGVDSP SVEDACGGGN TGGGLPLKKG PWTSAEDAIL VEYVTKHGEG  60
NWNAVQKHSG LARCGKSCRL RWANHLRPDL KKGAFTPEEE RRIIELHAKM GNKWARMAAE  120
SAQYAKQKRH AYTLAASLER NVPRNYLNEL KARCNIEKVK VLTVNALLLG RRDKFLHSFC  180
GFCDVPSPLF RHMVHMILLK LPGRTDNEIK NYWNTRIKRR QRAGLPIYPP DICFQTISEN  240
KQNEELGTFS STDSPFPDFL PMNNFEIPAV EFKRLEFNQQ LCPQALLDIP TGGILDIPGR  300
SLLAQGLNSA YYNRSFFSTT HPAKRIRGSE SLFSCLTGDC SPSKNDGSFP TCHQYQDGGS  360
LLAQSMGFSS SFNQNLTSDH HPSSLGVIPG SHALLNGNTS SSEPSWAKKL ELPSLQSQMA  420
SRGLPSSPLP SLESVETLIQ SPLTEHTESC HLSPRNSGLL DAVLYESQTM RGSKGILHQE  480
NSGDVVDNSC PDLHETEWEP YGDPISPLGH SAASVFSEYT PTSGSSSEEP QLVPIPACKI  540
KQEKFDFGPY DGQDDASNLI RSRPDYLLDS NCFGHMQHTD KAVDVVLVHR MPCLLSSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2134118185B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1754750.0EF175475.1 Solanum lycopersicum GAMYB-like2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361138.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_006361139.10.0PREDICTED: transcription factor GAMYB-like isoform X2
TrEMBLM1A5J50.0M1A5J5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000151560.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.29e-41myb domain protein 101