PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00779.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 468aa    MW: 52495.2 Da    PI: 6.5093
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00779.1_g00015.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS466.91.1e-142474651374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                              l++lLl+cA++v+sg+le+a+ +L ++s+lasp+gd+mqR+a+yf eALa r++rs+++lykal++++ s   +see+ ++k+f+e
  Sme2.5_00779.1_g00015.1  47 LIHLLLACANHVASGSLENANIALDHISQLASPSGDTMQRIASYFNEALADRILRSWPGLYKALRSTKLS--VVSEEILVRKMFFE 130
                              689*************************************************************999998..6************* PP

                     GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                              ++P+lk+++++ NqaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L + Ae+l
  Sme2.5_00779.1_g00015.1 131 IFPFLKVAFVVSNQAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLIQEAEKL 212
                              ***************************************************************....9****************** PP

                     GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll............................................ 214
                              ++pf+fn  v+++le+l++e+Lrvk+gEala+++v+qlh+ll                                            
  Sme2.5_00779.1_g00015.1 213 DIPFQFNQ-VVSKLENLDVERLRVKTGEALAISSVMQLHTLLahenekksslpfkhsngvglhralvnqktlgefpekdianccst 297
                              ********.799************************************************************************** PP

                     GRAS 215 ..........desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                                         ++       + d +L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le++lpr+s er kvE++
  Sme2.5_00779.1_g00015.1 298 sndtasssplCST----GssKMDCFLNALWGLSPKVMVVTEQDSNHNGTTLMERLSESLHFYAALFDCLESTLPRTSLERLKVEKM 379
                              *999875443333....2346799************************************************************** PP

                     GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              llg+ei++++aceg er+erhe+le+W +r++++GF++vpls++a  qa++ll+ ++ +gy+++ee+g++v++W+dr+L+svS+Wr
  Sme2.5_00779.1_g00015.1 380 LLGEEIKSIIACEGIERKERHEKLERWFQRFDTSGFGNVPLSYYALLQARRLLQSYSCEGYKIKEENGCVVICWQDRALFSVSSWR 465
                              *************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.98321445IPR005202Transcription factor GRAS
PfamPF035144.0E-14047465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPLEAFP MMSASPSFGS SNPWLKELKS EERGLYLIHL LLACANHVAS  60
GSLENANIAL DHISQLASPS GDTMQRIASY FNEALADRIL RSWPGLYKAL RSTKLSVVSE  120
EILVRKMFFE IFPFLKVAFV VSNQAIIEAM EGEKMVHIVD LNAAEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLIQEAE KLDIPFQFNQ VVSKLENLDV ERLRVKTGEA  240
LAISSVMQLH TLLAHENEKK SSLPFKHSNG VGLHRALVNQ KTLGEFPEKD IANCCSTSND  300
TASSSPLCST GSSKMDCFLN ALWGLSPKVM VVTEQDSNHN GTTLMERLSE SLHFYAALFD  360
CLESTLPRTS LERLKVEKML LGEEIKSIIA CEGIERKERH EKLERWFQRF DTSGFGNVPL  420
SYYALLQARR LLQSYSCEGY KIKEENGCVV ICWQDRALFS VSSWRCRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A9e-41354677381Protein SCARECROW
5b3h_A9e-41354676380Protein SCARECROW
5b3h_D9e-41354676380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349782.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM1A0990.0M1A099_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]