PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_00669.1_g00014.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 85aa MW: 9354.45 Da PI: 8.7864 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104 | 9.4e-33 | 21 | 76 | 2 | 58 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 +++rY eC++NhAa++Gg+avDGC+Efm+s ge+gt aal+CaACgCHRnFHRrev+ Sme2.5_00669.1_g00014.1 21 RNIRYVECQRNHAANIGGYAVDGCREFMAS-GEDGTNAALTCAACGCHRNFHRREVD 76 579**************************9.999********************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-23 | 2 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 6.7E-31 | 23 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 3.5E-27 | 24 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.714 | 25 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048509 | Biological Process | regulation of meristem development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MMKKRQVVVR RNTSGSSTRA RNIRYVECQR NHAANIGGYA VDGCREFMAS GEDGTNAALT 60 CAACGCHRNF HRREVDGGEV VSESF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016567575.1 | 2e-48 | PREDICTED: uncharacterized protein LOC107865897 | ||||
Refseq | XP_016567576.1 | 2e-48 | PREDICTED: uncharacterized protein LOC107865897 | ||||
Swissprot | Q2Q493 | 5e-33 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | A0A1U8G8B9 | 3e-47 | A0A1U8G8B9_CAPAN; uncharacterized protein LOC107865897 | ||||
TrEMBL | A0A1U8G8V9 | 3e-47 | A0A1U8G8V9_CAPAN; Mini zinc finger protein 1 | ||||
TrEMBL | A0A2G3CZE3 | 3e-47 | A0A2G3CZE3_CAPCH; Mini zinc finger protein 1 | ||||
STRING | PGSC0003DMT400050286 | 2e-46 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 2e-35 | mini zinc finger |