PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_00595.1_g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 143aa MW: 16252.2 Da PI: 9.1381 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 62.7 | 8.2e-20 | 8 | 60 | 2 | 56 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 +y+GVr+++ +g+++AeIrdp+++ + r +lg+f+taeeAa+a+++a +l+g+ Sme2.5_00595.1_g00010.1 8 KYRGVRRRP-WGKFAAEIRDPTTRP-SSRQWLGTFDTAEEAARAYDKASFNLRGH 60 8********.**********98833.49*************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00018 | 6.78E-31 | 8 | 68 | No hit | No description |
Pfam | PF00847 | 1.2E-13 | 8 | 60 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 2.09E-21 | 8 | 68 | IPR016177 | DNA-binding domain |
Gene3D | G3DSA:3.30.730.10 | 1.7E-29 | 8 | 69 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 5.9E-34 | 8 | 73 | IPR001471 | AP2/ERF domain |
PROSITE profile | PS51032 | 23.881 | 8 | 67 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 3.3E-11 | 9 | 20 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 3.3E-11 | 33 | 49 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MQEKEEVKYR GVRRRPWGKF AAEIRDPTTR PSSRQWLGTF DTAEEAARAY DKASFNLRGH 60 LATLNFPNEY YNQLPCPPLY YDNSICSSKN NVTSNNIPRG KGSSSTSPTN KLAREVIELP 120 CLDNSVLEEL LGAEDPKRVT KRN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5wx9_A | 3e-27 | 5 | 70 | 11 | 75 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006354547.1 | 3e-84 | PREDICTED: ethylene-responsive transcription factor ERF098-like | ||||
Swissprot | Q9LTC5 | 4e-38 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | M1DZV1 | 1e-82 | M1DZV1_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400097075 | 2e-83 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA21 | 24 | 1165 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23230.1 | 2e-40 | ERF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|