PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00386.1_g00001.1
Organism
Solanum melongena
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bHLH
Protein Properties Length: 92aa    MW: 10430.7 Da    PI: 8.5287
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00386.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.43.3e-1020601454
                             HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                      HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                             d+iN+  ++L++llP++ + +s K+s + +L+++++YIksL
  Sme2.5_00386.1_g00001.1 20 DQINDLVSKLQQLLPELRNRSSDKVSASRVLQETCNYIKSL 60
                             79**************8799********************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.125660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-72060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.3E-102079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.8E-102076IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0010086Biological Processembryonic root morphogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSSR HSGGSRISED QINDLVSKLQ QLLPELRNRS SDKVSASRVL QETCNYIKSL  60
HREVDDLSDR LSELLESSDT TQAALLRSLL MQ
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20023194, ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:22339648}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20305124}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}.
UniProtINDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754456e-60HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755186e-60HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022736077.12e-46transcription factor PRE3-like
SwissprotF4JCN98e-36PRE4_ARATH; Transcription factor PRE4
SwissprotQ9CA648e-36PRE3_ARATH; Transcription factor PRE3
TrEMBLA0A1S4C1K21e-42A0A1S4C1K2_TOBAC; transcription factor PRE3-like
STRINGSolyc06g070910.2.11e-43(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35324161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74500.13e-26activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Lu KJ,De Rybel B,van Mourik H,Weijers D
    Regulation of intercellular TARGET OF MONOPTEROS 7 protein transport in the Arabidopsis root.
    Development, 2018.
    [PMID:29358212]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]