PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00121.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 1416aa    MW: 160093 Da    PI: 8.3075
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00121.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.65.8e-14299314131374
                     GRAS    1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84  
                               l++lLl+cA++vs+g+le+a+ +L ++s+lasp+gd+mqR+a+yf+eALa r++rs++++ykal++++ +   +se + + k+f
  Sme2.5_00121.1_g00003.1  993 LIHLLLTCANHVSAGNLENANIALDQISHLASPNGDTMQRIASYFAEALADRILRSWNGIYKALNSTKLR--VVSEDILVKKMF 1074
                               689**************************************************************99998..69********** PP

                     GRAS   85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168 
                               +e +P+lk++ ++aNqaI ea+ege+ vHi+D+++s++lQW aLlq L++Rpegpp+lRiTgv++    +k+ le++++ L++ 
  Sme2.5_00121.1_g00003.1 1075 FEYFPFLKVASVIANQAIIEAMEGEKVVHIVDLNASEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKQVLEQIAHVLTEE 1154
                               *****************************************************************....9************** PP

                     GRAS  169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll...................................... 214 
                               Ae+l+vpf+f+  v+ +le+l++e+Lrvk+gEala+++v+qlh+ll                                      
  Sme2.5_00121.1_g00003.1 1155 AEKLDVPFQFHQ-VVGKLENLDIEKLRVKTGEALAISSVMQLHTLLahedeppkksplafkhlnglhlqrailnqntlgdllek 1237
                               ************.7999******************************************************************* PP

                     GRAS  215 ..................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280 
                                                 ++++s+  + d +L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le +l r+s 
  Sme2.5_00121.1_g00003.1 1238 ettnvfspgnesasssplSSTAST--KMDGFLHALWGLSPKVMVVTEQDSNHNGTTLMERLSESLYFYAALFDCLEFTLQRTSL 1319
                               ************887654333333..4699****************************************************** PP

                     GRAS  281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364 
                               er kvE++l+g+ei+n+vaceg er+erhe+l kW +r++ aGF++vpls++a+ qa++ll+ ++ +gy+++eesgs+v++W+d
  Sme2.5_00121.1_g00003.1 1320 ERLKVEKMLFGEEIKNIVACEGGERKERHEKLDKWFQRFDGAGFRNVPLSYYAMLQARRLLQSYSCEGYKIKEESGSVVICWHD 1403
                               ************************************************************************************ PP

                     GRAS  365 rpLvsvSaWr 374 
                               r+L+svSaWr
  Sme2.5_00121.1_g00003.1 1404 RALFSVSAWR 1413
                               *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF536868.86E-36594705IPR001926Tryptophan synthase beta subunit-like PLP-dependent enzyme
Gene3DG3DSA:3.40.50.11009.4E-17613709No hitNo description
Gene3DG3DSA:3.40.50.11008.7E-30735913No hitNo description
SuperFamilySSF536868.86E-36737916IPR001926Tryptophan synthase beta subunit-like PLP-dependent enzyme
PROSITE profilePS5098558.9729671393IPR005202Transcription factor GRAS
PfamPF035142.0E-1399931413IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1416 aa     Download sequence    Send to blast
MIWPSKLTRK VKTPTKVSCF VFAGHKEGLL NTRLYKEEVY RYAQDASFVE KMQKAMRLIC  60
FYIVGEQQIC RTCSLYTRSL LNTRLYKEEV YRYAQDASFV EKMQKAMRLI CFYIVGEQQI  120
CRTCSLYTRT TRNTRFSASQ SGDHFSANPA TRLLVMDVEI KREKKKKVLY AKPKIRWEGL  180
TSALSHEMEE KLINLEAWSS ECNMNSMWDT TAGYIRKVAT EVLGVSRRAF GGRQGDWWWN  240
DEVQGKVKDK KVAYTEWLEC RDEEEKQKLK TAKLPDEWRS TMVPLYKNKG DIKNCNNYRG  300
IKLLSHTMKI WKRVVEMRVR RVISISENQF EFMPGRSTTE AYDKVPRDVL WRCLEMKDVP  360
MAYIKAIKDM YDGAETREEV PWCMLFADDI VFIDDTRTKV NDRLEAWRHA LKSKGFKLSR  420
TKTEYLGCKF SVERDKANFD VRQDDVYQTL AWTKWRLASG VVCDKKIPPK LKCKFYKLVV  480
RPSFLSDKVR NETIREKLEQ QRNGMILSST LSIHCGASSP NLLKEMSKAN FSKEEHVSRF  540
LKRKWALRSP DTKINQIMIS KDGLQQGCEN LGNLSFMNNP QPFMDDHVTR NNRQDPSFYV  600
VRDDLLHPLV NGNKARKLDA LLPLLEDCSV TDVVTCGGCQ SAHAAAVAVS CAERGLKSHL  660
LLRGEQPATL TGYNLISTLY GNVSYVPRSL YAGREEMLSK HAHIVAGNGG LVISLADLEA  720
SLSSHRCGEH SPHMDALTKG SKKVAIINEG AGDAAALLGV VRLVEYLSQD HLFGKDQQLK  780
IIIDAGTGTT AVGFGIGAMC LGLPWEVTAV MLADTIDGYQ KKEESLISEF HRCFTLQLDE  840
QVQTGLEGGL VHWVERSSPR KFGNILKGEV EICRKIAQET GILLDPVYTL AAWELATQVG  900
QEECAKVVML HTGVNGSNLR DIIHLGCGSP KVVSMVSEPP TILCAHGALD GDTDDGSSSV  960
TSSSPLMSHS PSFGGSPYQW LKDLKSEDRG LYLIHLLLTC ANHVSAGNLE NANIALDQIS  1020
HLASPNGDTM QRIASYFAEA LADRILRSWN GIYKALNSTK LRVVSEDILV KKMFFEYFPF  1080
LKVASVIANQ AIIEAMEGEK VVHIVDLNAS EPLQWRALLQ DLSARPEGPP HLRITGVHQQ  1140
KQVLEQIAHV LTEEAEKLDV PFQFHQVVGK LENLDIEKLR VKTGEALAIS SVMQLHTLLA  1200
HEDEPPKKSP LAFKHLNGLH LQRAILNQNT LGDLLEKETT NVFSPGNESA SSSPLSSTAS  1260
TKMDGFLHAL WGLSPKVMVV TEQDSNHNGT TLMERLSESL YFYAALFDCL EFTLQRTSLE  1320
RLKVEKMLFG EEIKNIVACE GGERKERHEK LDKWFQRFDG AGFRNVPLSY YAMLQARRLL  1380
QSYSCEGYKI KEESGSVVIC WHDRALFSVS AWRCRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-3997714152380Protein SCARECROW
5b3h_D2e-3997714152380Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3