PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g099900.1.1
Common NameLOC101253266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 469aa    MW: 52609.3 Da    PI: 6.4502
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g099900.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS479.81.4e-146474651374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lLl+cA++v+sg+le+a+ +L ++s+lasp+gd+mqR+a+yfteALa r++rs+++lykal++++ s   +see+ ++k+f+e++P+l
  Solyc12g099900.1.1  47 LIHLLLACANHVASGSLENANIALDHISQLASPSGDTMQRIASYFTEALADRILRSWPGLYKALRSTKLS--VVSEEILVRKMFFEIFPFL 135
                         689*************************************************************999998..6****************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         k++++++NqaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+fn  v
  Solyc12g099900.1.1 136 KVAFVVTNQAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTQEAEKLDIPFQFNQ-V 221
                         **********************************************************....9**************************.7 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrll......................................................desvs 219
                         ++rle+l++e+Lrvk+gEala+++++qlh+ll                                                       +++s
  Solyc12g099900.1.1 222 VSRLENLDVEKLRVKTGEALAISSIMQLHTLLahdndkksplpfkhsngvnlnralvnqntlgeflekdmangcspsndtasssplCSTGS 312
                         ******************************************************************************9988555433333 PP

                GRAS 220 leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhe 310
                         +  + d++L+++++lsPkv+vv+eq+a+hn+++++er++e+l++y+alfd+le++lpr+s er kvE++llg+ei+n++aceg er+erhe
  Solyc12g099900.1.1 313 T--KMDSFLNALWGLSPKVMVVTEQDANHNGTTLMERLSESLHFYAALFDCLESTLPRTSLERLKVEKMLLGEEIRNIIACEGIERKERHE 401
                         3..5699************************************************************************************ PP

                GRAS 311 tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         +lekW +r++++GF++vpls++a+ qa++ll+ ++ +gy+++e++g++v++W+drpL+svS+Wr
  Solyc12g099900.1.1 402 KLEKWFQRFDTSGFGNVPLSYYAMLQARRLLQSYSCEGYKIKEDNGCVVICWQDRPLFSVSSWR 465
                         ***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.76221445IPR005202Transcription factor GRAS
PfamPF035144.7E-14447465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPIQVFP MMSVSPSFGS SNQWLKELKS EERGLYLIHL LLACANHVAS  60
GSLENANIAL DHISQLASPS GDTMQRIASY FTEALADRIL RSWPGLYKAL RSTKLSVVSE  120
EILVRKMFFE IFPFLKVAFV VTNQAIIEAM EGEKMVHIVD LNAAEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLTQEAE KLDIPFQFNQ VVSRLENLDV EKLRVKTGEA  240
LAISSIMQLH TLLAHDNDKK SPLPFKHSNG VNLNRALVNQ NTLGEFLEKD MANGCSPSND  300
TASSSPLCST GSTKMDSFLN ALWGLSPKVM VVTEQDANHN GTTLMERLSE SLHFYAALFD  360
CLESTLPRTS LERLKVEKML LGEEIRNIIA CEGIERKERH EKLEKWFQRF DTSGFGNVPL  420
SYYAMLQARR LLQSYSCEGY KIKEDNGCVV ICWQDRPLFS VSSWRCRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-40294671381Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.107800.0flower| fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g099900.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252879.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A3Q7JDZ10.0A0A3Q7JDZ1_SOLLC; Uncharacterized protein
STRINGSolyc12g099900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Representative plantOGRP25641433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  3. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  4. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]