PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g099140.1.1
Common NameLOC101244852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 301aa    MW: 35121.7 Da    PI: 6.1758
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g099140.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-163784148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd  l + ++++G g+W++ ar  g++Rt+k+c++rw++yl
  Solyc12g099140.1.1 37 RGSWTVEEDFTLMNHIALHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 84
                        89********************************************97 PP

2Myb_DNA-binding50.64.6e-1690133146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Solyc12g099140.1.1  90 RGNITLEEQLLILQLHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 133
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6563284IPR017930Myb domain
SuperFamilySSF466895.62E-3034131IPR009057Homeodomain-like
SMARTSM007171.3E-133686IPR001005SANT/Myb domain
PfamPF002494.5E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-213891IPR009057Homeodomain-like
CDDcd001671.13E-93984No hitNo description
PROSITE profilePS5129423.94785139IPR017930Myb domain
SMARTSM007172.6E-1489137IPR001005SANT/Myb domain
PfamPF002497.5E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2292138IPR009057Homeodomain-like
CDDcd001671.45E-6110133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDHHYHQYVE FGLKREDNID SNDRKGDENN NNLDLKRGSW TVEEDFTLMN HIALHGEGRW  60
NSLARSAGLK RTGKSCRLRW LNYLRPDVRR GNITLEEQLL ILQLHSRWGN RWSKIAQYLP  120
GRTDNEIKNY WRTRVQKQAK QLKCDVNSKE FKDTLHYLWI PRLVERIQAS SNSNSNNQVN  180
LQQTNDNIII TNNNNIINNN NIVPNMNFTQ ENYSSTTTTS SENSIGTQIS DMSDNCYTNY  240
PLNQGDYGEI LISPTGDYFQ HGGIFDDNNH HQNMNQLFLD DNVCDNMWNS DDMLFLQQLN  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-253213922128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.236660.0fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g099140.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252934.10.0transcription factor MYB108-like
SwissprotQ10MB42e-83MYB2_ORYSJ; Transcription factor MYB2
TrEMBLM1A0321e-170M1A032_SOLTU; Uncharacterized protein
STRINGSolyc12g099140.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-76myb domain protein 108
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  4. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  5. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  6. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]