PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc12g019840.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 65aa MW: 7798.74 Da PI: 10.5974 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.6 | 2.8e-18 | 5 | 51 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + rW + Ede+l+++v+++G ++W+ I++ ++ Rt+k+c++rw ++l Solyc12g019840.1.1 5 KRRWNPREDERLKRLVEKHGAKNWSFISQSFP-SRTEKSCRERWCNHL 51 579*****************************.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.611 | 1 | 55 | IPR017930 | Myb domain |
SMART | SM00717 | 2.7E-16 | 4 | 53 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.9E-17 | 5 | 51 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.52E-19 | 5 | 58 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.24E-14 | 7 | 51 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-22 | 7 | 64 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
MGQIKRRWNP REDERLKRLV EKHGAKNWSF ISQSFPSRTE KSCRERWCNH LNPQSNHHPL 60 TTEE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3osf_A | 3e-14 | 5 | 64 | 11 | 69 | MYB21 |
3osf_D | 3e-14 | 5 | 64 | 11 | 69 | MYB21 |
3osg_A | 3e-14 | 5 | 64 | 11 | 69 | MYB21 |
3osg_D | 3e-14 | 5 | 64 | 11 | 69 | MYB21 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc12g019840.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015060233.1 | 1e-36 | transcription factor MYB44-like | ||||
Swissprot | Q9FDW1 | 1e-19 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A3Q7J790 | 5e-40 | A0A3Q7J790_SOLLC; Uncharacterized protein | ||||
STRING | Solyc12g019840.1.1 | 9e-41 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA30250 | 2 | 2 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 4e-22 | myb domain protein r1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc12g019840.1.1 |