PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc11g010570.1.1 | ||||||||
Common Name | J | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 266aa MW: 30426.3 Da PI: 7.3892 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.4 | 9.1e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n++ rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl++yss Solyc11g010570.1.1 9 KKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 53.6 | 9.8e-19 | 92 | 173 | 19 | 100 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++++L kei++ + +R++ Ge+L+ L+++eLqqLe+ Le++l+++ ++K + ++++i++lq+k l een++Lr++++e Solyc11g010570.1.1 92 SNYSRLSKEISEKSHRLRQMRGEELQGLNIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVME 173 6799***************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.501 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.11E-39 | 2 | 77 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.28E-31 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 14.044 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.3E-16 | 92 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000003 | anatomy | whole plant | ||||
PO:0000146 | anatomy | abscission zone | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009010 | anatomy | seed | ||||
PO:0020142 | anatomy | stem internode |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 266 aa Download sequence Send to blast |
MAREKIQIKK IDNSTARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFDYSSS 60 SMKQILERRD LHSKNLEKLD QPSLELQLVE NSNYSRLSKE ISEKSHRLRQ MRGEELQGLN 120 IEELQQLERS LETGLSRVIE RKGDKIMREI NQLQQKGMHL MEENEKLRQQ VMEISNNNNN 180 NNNGYREAGV VIFEPENGFN NNNNEDGQSS ESVTNPCNSI DPPPQDDDSS DTSLKLGLAT 240 LLRLKRSKAR CGYFCMLLEE GEKKK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 3e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 3e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 3e-20 | 1 | 66 | 1 | 66 | MEF2C |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.10394 | 0.0 | callus| flower| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc11g010570.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC212435 | 1e-113 | Solanum lycopersicum chromosome 11 clone C11HBa0107K14, complete sequence | |||
GenBank | AF275345 | 1e-113 | Lycopersicon esculentum putative permease gene, partial cds; suppressor-like protein, putative centromere protein, putative auxin growth promotor protein, and putative protein phosphatase genes, complete cds; LTR-A long terminal repeat, complete sequence; putative copia-like polyprotein gene, complete cds; LTR-B long terminal repeat, complete sequence; MADS-box transcription factor JOINTLESS gene, complete cds; TH65-like protein gene, partial cds; and unknown genes |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001306770.1 | 1e-171 | MADS-box protein JOINTLESS | ||||
Swissprot | Q9FUY6 | 0.0 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | M1BBZ0 | 1e-150 | M1BBZ0_SOLTU; Uncharacterized protein | ||||
STRING | Solyc11g010570.1.1 | 0.0 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 | Representative plant | OGRP6076 | 11 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-101 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc11g010570.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|